Rabbit anti-NQO1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human NQO1 |
Rabbit anti-NQO1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human NQO1 |
Rabbit polyclonal antibody to NQO1 (NAD(P)H dehydrogenase, quinone 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 213 and 274 of NQO1 (Uniprot ID#P15559) |
Rabbit polyclonal NQO1 Antibody (Center)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This NQO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 118-144 amino acids from the Central region of human NQO1. |
Rabbit Polyclonal NQO-1 Antibody
Applications | IHC, WB |
Reactivities | Canine, Human, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acid 250-274 of human NQO1 was used as the immunogen. |
Rabbit Polyclonal Anti-NQO1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NQO1 antibody: synthetic peptide directed towards the C terminal of human NQO1. Synthetic peptide located within the following region: WKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVG |
Anti-NQO1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 260-274 amino acids of Human NAD(P)H dehydrogenase, quinone 1 |
NQO1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
NQO1 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-274 of human NQO1 (NP_000894.1). |
Modifications | Unmodified |
NQO1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-274 of human NQO1 (NP_000894.1). |