Antibodies

View as table Download

Rabbit anti-NQO1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human NQO1

Rabbit polyclonal antibody to NQO1 (NAD(P)H dehydrogenase, quinone 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 213 and 274 of NQO1 (Uniprot ID#P15559)

Rabbit polyclonal NQO1 Antibody (Center)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This NQO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 118-144 amino acids from the Central region of human NQO1.

Rabbit Polyclonal NQO-1 Antibody

Applications IHC, WB
Reactivities Canine, Human, Primate
Conjugation Unconjugated
Immunogen A portion of amino acid 250-274 of human NQO1 was used as the immunogen.

Rabbit Polyclonal Anti-NQO1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NQO1 antibody: synthetic peptide directed towards the C terminal of human NQO1. Synthetic peptide located within the following region: WKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVG

Anti-NQO1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 260-274 amino acids of Human NAD(P)H dehydrogenase, quinone 1

NQO1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated

NQO1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-274 of human NQO1 (NP_000894.1).
Modifications Unmodified

NQO1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-274 of human NQO1 (NP_000894.1).