Rabbit polyclonal Smad1 (Ser187) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Smad1 around the phosphorylation site of serine 187 (P-H-SP-P-N). |
| Modifications | Phospho-specific |
Rabbit polyclonal Smad1 (Ab-465) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Smad1 around the phosphorylation site of serine 465 (I-S-S-V-SP). |
Rabbit polyclonal anti-Wnt-6 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 276 of mouse Wnt-6 |
Rabbit polyclonal SMAD3 phospho S423/phospho S425 antibody
| Applications | IHC, WB |
| Reactivities | Human, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 417-425 of human SMAD3 protein. |
Rabbit polyclonal anti-DELTA-4 antibody
| Applications | IHC, WB |
| Reactivities | Human, partial reactivity to Mouse and Rat |
| Conjugation | Unconjugated |
| Immunogen | Anti-DELTA-4 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of Human DELTA-4. |
Anti-Human BMP-7 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CHO cells derived Recombinant Human BMP-7 |
Rabbit Polyclonal anti-GLI2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLI2 antibody: synthetic peptide directed towards the N terminal of human GLI2. Synthetic peptide located within the following region: RNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTE |
Rabbit Polyclonal Anti-WNT7B Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT7B antibody: synthetic peptide directed towards the middle region of human WNT7B. Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM |
Rabbit Polyclonal Anti-BMP6 Antibody - middle region
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BMP6 antibody: synthetic peptide directed towards the middle region of human BMP6. Synthetic peptide located within the following region: MVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSEL |
Rabbit Polyclonal Anti-WNT8B Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Wnt8b antibody is: synthetic peptide directed towards the C-terminal region of Mouse Wnt8b. Synthetic peptide located within the following region: SISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRR |
Rabbit Polyclonal Anti-NODAL Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NODAL antibody: synthetic peptide directed towards the middle region of human NODAL. Synthetic peptide located within the following region: EFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHH |
Rabbit Polyclonal Anti-NODAL Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NODAL antibody: synthetic peptide directed towards the N terminal of human NODAL. Synthetic peptide located within the following region: PSSPSPLAYMLSLYRDPLPRADIIRSLQAEDVAVDGQNWTFAFDFSFLSQ |
Rabbit Polyclonal Anti-OCT3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OCT3 Antibody: A synthesized peptide derived from human 41185 |
Rabbit Polyclonal Anti-EGFR Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGFR Antibody: A synthesized peptide derived from human EGFR |
Rabbit Polyclonal Anti-Smad1/5/9 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Smad1/5/9 Antibody: A synthesized peptide derived from human Smad1/5/9 |
Rabbit Polyclonal Anti-CD34 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD34 Antibody: A synthesized peptide derived from human CD34 |
Rabbit Polyclonal Anti-Notch 1 (Cleaved-Val1744) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Notch 1 (Cleaved-Val1744) Antibody: A synthesized peptide derived from human Notch 1 (Cleaved-Val1744) |
Rabbit Polyclonal Anti-Phospho-Smad1 (Ser187) Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-Smad1 (Ser187) Antibody: A synthesized peptide derived from human Smad1 around the phosphorylation site of Serine 187 |
| Modifications | Phospho-specific |
Rabbit Monoclonal Antibody against NODAL (Clone EP2058Y)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against OCT4 - Embryonic Stem Cell Marker
| Applications | FC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal portion of the human OCT4 protein sequence (between residues 100-200). |
Rabbit Polyclonal antibody to CD44 (CD44 molecule (Indian blood group))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 258 of CD44 |
Rabbit polyclonal Smad2 (Ab-220) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Smad2 around the phosphorylation site of threonine 220 (P-E-TP-P-P). |
Rabbit polyclonal Smad2 (Thr220) antibody(Phospho-specific)
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Smad2 around the phosphorylation site of threonine 220 (P-E-TP-P-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal Smad3 (Ab-204) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Smad3 around the phosphorylation site of serine 204 (A-G-SP-P-N). |
Rabbit polyclonal Smad3 (Ser204) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Smad3 around the phosphorylation site of serine 204 (A-G-SP-P-N). |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Tyr1172) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-Smad1/5/9 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human Smad1/5/9. |
Rabbit polyclonal anti-BMP8B antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BMP8B. |
Rabbit polyclonal anti-WNT1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human WNT1. |
Rabbit polyclonal anti-GDF7 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GDF7. |
Rabbit polyclonal anti-EGFR antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This whole rabbit serum was prepared by repeated immunizations with a peptide synthesized using conventional technology. The sequence of the epitope maps to a region near the carboxy terminus which is identical in human, mouse and rat EGFR. |
Anti-WNT5A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 280 amino acids of human wingless-type MMTV integration site family, member 5A |
Rabbit polyclonal EGFR-S1026 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This EGFR-S1026 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1004-1033 amino acids from the C-terminal region of human EGFR-S1026. |
Rabbit Polyclonal CD44 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD44 |
Rabbit Polyclonal EGFR Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR |
Rabbit Polyclonal EGFR Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR |
Rabbit Polyclonal EGFR (Ser1026) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Serine 1026 |
| Modifications | Phospho-specific |
Rabbit Polyclonal EGFR (Ser1070) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human EGFR around the phosphorylation site of Serine 1070 |
| Modifications | Phospho-specific |
Germany
Japan
United Kingdom
China
