Rabbit Polyclonal MeCP2 Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MeCP2 antibody: MeCP2 (Methyl-CpG-binding domain protein 2), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein. |
Rabbit Polyclonal MeCP2 Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MeCP2 antibody: human MeCP2 (Methyl-CpG-binding domain protein 2), using 3 different KLH-conjugated synthetic peptides containing an amino acid sequence from the N-terminal, the central and the C-terminal part of the protein, respec |
Rabbit Anti-MeCP2 (Ser80) Antibody (Phospho-Specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser80 conjugated to KLH |
| Modifications | Phospho-specific |
Rabbit Polyclonal MeCP2 Antibody
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Immunogen | The immunogen for anti-MeCP2 antibody: mouse MeCP2 (Methyl-CpG-binding domain Protein 2), using a KLH-conjugated synthetic peptide containing an amino acid sequence from the N-terminal part of the protein. |
Rabbit Polyclonal Anti-MECP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MECP2 antibody: synthetic peptide directed towards the N terminal of human MECP2. Synthetic peptide located within the following region: KKEEKEGKHEPVQPSAHHSAEPAEAGKAETSEGSGSAPAVPEASASPKQR |
Rabbit Polyclonal Anti-MECP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MECP2 Antibody: synthetic peptide directed towards the N terminal of human MECP2. Synthetic peptide located within the following region: MVAGMLGLREEKSEDQDLQGLKEKPLKFKKVKKDKKEDKEGKHEPLQPSA |
Rabbit Polyclonal Anti-MECP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MECP2 antibody: synthetic peptide directed towards the middle region of human MECP2. Synthetic peptide located within the following region: EPAKTQPAVATAATAAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTPV |
Rabbit Polyclonal MeCP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | The immunogen for anti-MeCP2 antibody: human MeCP2 (Methyl-CpG-binding domain protein 2), using a recombinant protein. |
Germany
Japan
United Kingdom
China
