Antibodies

View as table Download

Cathepsin K Rabbit anti-Rat Polyclonal Antibody

Applications IHC
Reactivities Chicken, Human, Mouse, Rabbit, Rat, Pig
Conjugation Unconjugated
Immunogen CTSK / Cathepsin K antibody was raised against synthetic peptide surrounding amino acid 321 of rat cathepsin K.

Cathepsin K Rabbit anti-Rat Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CTSK / Cathepsin K antibody was raised against synthetic peptide surrounding amino acid 321 of rat cathepsin K.

Cathepsin K (CTSK) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Bovine, Human, Monkey, Porcine, Rabbit
Immunogen KLH conjugated synthetic peptide between aa 207-27 from the Center region of human CTSK.

Cathepsin K (CTSK) (Center) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 96-126 amino acids from the Central region of Human Cathepsin K

Rabbit Polyclonal Anti-CTSK Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-CTSK antibody: synthetic peptide directed towards the middle region of human CTSK. Synthetic peptide located within the following region: SPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMY

Rabbit Polyclonal Anti-CTSK Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CTSK