Germany
Japan
United Kingdom
China
Rabbit anti-AMPH Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AMPH |
Antibodies
View as table Download
Rabbit polyclonal AMPH antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AMPH. |
Rabbit Polyclonal Amphiphysin Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal Anti-GSN Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GSN Antibody: synthetic peptide directed towards the C terminal of human GSN. Synthetic peptide located within the following region: KPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSN |
Anti-AMPH Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human amphiphysin |
Anti-GSN Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 768-782 amino acids of Human gelsolin |
AMPH Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human AMPH |
Active filters
Antibody Hosts
- Rabbit
Families
- Secreted Protein
Pathways
- Fc gamma R-mediated phagocytosis