Rabbit Monoclonal Antibody against MUC1 (Clone EP1024Y)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Monoclonal Antibody against MUC1 (Clone EP1024Y)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal CD227/MUC1 (Tyr1229) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CD227/MUC1 around the phosphorylation site of tyrosine 1229 (S-P-YP-E-K) |
Modifications | Phospho-specific |
Rabbit Polyclonal MUC-1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
Conjugation | Unconjugated |
Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal Anti-Phospho-CD227/MUC1(Tyr1229) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Phospho-CD227/MUC1(Tyr1229) Antibody: A synthesized peptide derived from human CD227/MUC1 around the phosphorylation site of Tyrosine 1229 |
Modifications | Phospho-specific |
EMA (MUC1) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC |
Reactivities | Human, Mouse |
Rabbit polyclonal CD227/MUC1 antibody
Applications | IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CD227/MUC1. |
EMA (MUC1) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to human CD227 / Mucin-1 / MUC1 (between 1202-1231aa) |
Rabbit polyclonal anti-PGRMC2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human PGRMC2. |
Rabbit Polyclonal MUC1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | MUC1 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human MUC1. The immunogen is located within the last 50 amino acids of MUC1 . |
Rabbit Polyclonal Anti-MUC1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MUC1 |
Rabbit Polyclonal Anti-MUC1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MUC1 |
Rabbit Polyclonal Anti-MUC1(NT) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MUC1(NT) |
Rabbit Polyclonal Anti-MUC1(CT) Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MUC1(CT) |