Antibodies

View as table Download

Rabbit anti-CALR Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CALR

Calreticulin (CALR) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FC, IHC, WB
Reactivities Human, Rat
Immunogen This CALR Antibody is generated from rabbits immunized with a recombinant protein of human CALR.

Rabbit polyclonal anti-CALR antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CALR.

Rabbit Polyclonal Anti-CALR Antibody - middle region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CALR antibody: synthetic peptide directed towards the middle region of human CALR. Synthetic peptide located within the following region: ASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWE

Calreticulin (CALR) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FC, IHC, WB
Reactivities Human, Rat
Immunogen This CALR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-305 amino acids from the Central region of Human CALR.

Rabbit Polyclonal anti-CALR Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep
Conjugation Unconjugated
Immunogen Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH

Rabbit Polyclonal Anti-CALR Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CALR antibody: synthetic peptide directed towards the middle region of human CALR. Synthetic peptide located within the following region: PDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVT

Rabbit Polyclonal Anti-CALR Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CALR antibody is: synthetic peptide directed towards the N-terminal region of Human CALR. Synthetic peptide located within the following region: SSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQ

Rabbit Polyclonal anti-CALR antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CALR antibody: synthetic peptide directed towards the C terminal of human CALR. Synthetic peptide located within the following region: KEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL

Rabbit Polyclonal Calreticulin Antibody

Applications WB
Reactivities Human, Mouse, Rat, Bovine, Hamster, Primate
Conjugation Unconjugated
Immunogen A fusion protein to mouse Calreticulin [UniProt# P14211]

Rabbit Polyclonal Calreticulin Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A full-length protein to mouse Calreticulin [UniProt# P14211]

Rabbit Polyclonal anti-CALR antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-CALR antibody: synthetic peptide directed towards the C terminal of human CALR. Synthetic peptide located within the following region: FGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDK

Anti-CALR Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 20-218 amino acids of human calreticulin

Anti-CALR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 20-218 amino acids of human calreticulin