Rabbit anti-CAPN1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CAPN1 |
Rabbit anti-CAPN1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CAPN1 |
Rabbit Polyclonal Anti-CAPN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CAPN1 antibody: synthetic peptide directed towards the middle region of human CAPN1. Synthetic peptide located within the following region: EVEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLE |
Rabbit polyclonal anti-Calpain 1 antibody
Applications | WB |
Reactivities | Bovine, Human, Mouse, Rabbit, Rat, Pig |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 700 of rat Calpain 1 |
Rabbit Polyclonal Anti-CAPN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CAPN1 antibody: synthetic peptide directed towards the N terminal of human CAPN1. Synthetic peptide located within the following region: EFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDL |
Anti-CAPN1 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 543-713 amino acids of Human Calpain-1 catalytic subunit |
Anti-CAPN1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 543-713 amino acids of Human Calpain-1 catalytic subunit |