Rabbit polyclonal Anti-PSMB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMB2 antibody: synthetic peptide directed towards the middle region of human PSMB2. Synthetic peptide located within the following region: YDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERA |
Rabbit polyclonal Anti-PSMB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMB2 antibody: synthetic peptide directed towards the middle region of human PSMB2. Synthetic peptide located within the following region: LDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLD |
Rabbit polyclonal Anti-PSMB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMB3 antibody: synthetic peptide directed towards the middle region of human PSMB3. Synthetic peptide located within the following region: LNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF |
Rabbit polyclonal Anti-PSMB4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMB4 antibody: synthetic peptide directed towards the middle region of human PSMB4. Synthetic peptide located within the following region: YLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMV |
Rabbit polyclonal Anti-PSMB4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMB4 antibody: synthetic peptide directed towards the middle region of human PSMB4. Synthetic peptide located within the following region: SRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQ |
Rabbit polyclonal Anti-PSMB5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMB5 antibody: synthetic peptide directed towards the middle region of human PSMB5. Synthetic peptide located within the following region: IVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQ |
Rabbit polyclonal Anti-PSMB6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMB6 antibody: synthetic peptide directed towards the N terminal of human PSMB6. Synthetic peptide located within the following region: TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAA |
Rabbit polyclonal Anti-PSMB10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMB10 antibody: synthetic peptide directed towards the middle region of human PSMB10. Synthetic peptide located within the following region: DLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQG |
Rabbit polyclonal Anti-Psmc1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Psmc1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDG |
Rabbit polyclonal Anti-PSMD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMD1 antibody: synthetic peptide directed towards the N terminal of human PSMD1. Synthetic peptide located within the following region: HYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALE |
Rabbit polyclonal Anti-PSMD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMD1 antibody: synthetic peptide directed towards the N terminal of human PSMD1. Synthetic peptide located within the following region: DLYESASQQFLSSVIQNLRTVGTPIASVPGSTNTGTVPGSEKDSDSMETE |
Rabbit polyclonal Anti-PSMD3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMD3 antibody: synthetic peptide directed towards the N terminal of human PSMD3. Synthetic peptide located within the following region: RLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMDTEADLQFRPRTGKAAS |
Rabbit polyclonal Anti-PSMD3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMD3 antibody: synthetic peptide directed towards the middle region of human PSMD3. Synthetic peptide located within the following region: YSTREPQLAFHQRISFCLDIHNMSVKAMRFPPKSYNKDLESAEERREREQ |
Rabbit polyclonal Anti-PSME2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSME2 antibody: synthetic peptide directed towards the middle region of human PSME2. Synthetic peptide located within the following region: QEKVLERVNAVKTKVEAFQTTISKYFSERGDAVAKASKETHVMDYRALVH |
Rabbit polyclonal Anti-PSME2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSME2 antibody: synthetic peptide directed towards the middle region of human PSME2. Synthetic peptide located within the following region: SKETHVMDYRALVHERDEAAYGELRAMVLDLRAFYAELYHIISSNLEKIV |
Rabbit Polyclonal Anti-PSMC6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMC6 antibody: synthetic peptide directed towards the C terminal of human PSMC6. Synthetic peptide located within the following region: GFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDY |
Rabbit Polyclonal Anti-IFN-gamma Antibody
| Reactivities | Human, Rhesus Macaque |
| Conjugation | Unconjugated |
| Immunogen | For immunization recombinant human IFN-gamma (E.coli-derived) is used |
Rabbit Polyclonal Anti-IFN-gamma Antibody, Biotin conjugated
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | For immunization recombinant human IFN-gamma (E.coli-derived) is used |
Anti-PSMD3 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 |
Anti-PSMD3 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 |
Anti-PSMD14 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 216-310 amino acids of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 |
Anti-PSMD14 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 216-310 amino acids of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 |
Anti-PSMD6 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 371-384 amino acids of Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 |
Anti-PSMD6 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 371-384 amino acids of Human proteasome (prosome, macropain) 26S subunit, non-ATPase, 6 |
Anti-PSMD7 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 7 |
Anti-PSMD8 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-PSMD2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 2 |
Rabbit Polyclonal Anti-PSMC2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PSMC2 |
Rabbit Polyclonal Anti-PSMC1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PSMC1 |
Rabbit Polyclonal Anti-PSMD11 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PSMD11 |
PSMF1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PSMF1 |
Germany
Japan
United Kingdom
China
