ROR gamma (RORC) (Modulating Domain) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Human |
Immunogen | Synthetic 14 amino acid peptide from modulating domain of human ROR-gamma |
ROR gamma (RORC) (Modulating Domain) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Human |
Immunogen | Synthetic 14 amino acid peptide from modulating domain of human ROR-gamma |
Rabbit Polyclonal Anti-RORC Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RORC antibody is: synthetic peptide directed towards the N-terminal region of Human RORC. Synthetic peptide located within the following region: MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEG |
Rabbit polyclonal anti-RORG antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RORG. |
Rabbit Polyclonal ROR gamma/RORC/NR1F3 Antibody
Applications | IHC, WB |
Reactivities | Human, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 1-50 of human ROR gamma was used as the immunogen. |
Rabbit Polyclonal Anti-RORC Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RORC antibody: synthetic peptide directed towards the N terminal of human RORC. Synthetic peptide located within the following region: EPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKAS |
Rabbit Polyclonal Anti-RORC Antibody (Ligand-binding Domain)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | RORC / ROR Gamma antibody was raised against synthetic 18 amino acid peptide from ligand-binding domain of human ROR Gamma. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Tamarin, Elephant, Bat (100%); Bovine, Rabbit, Horse (94%); Mouse, Rat, Hamster, Panda (89%); Dog (83%). |
Rabbit Polyclonal Anti-RORC Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RORC Antibody: synthetic peptide directed towards the C terminal of human RORC. Synthetic peptide located within the following region: DEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILA |
Rabbit Polyclonal Anti-RORC Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RORC Antibody: synthetic peptide directed towards the middle region of human RORC. Synthetic peptide located within the following region: CHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPD |
Rabbit Polyclonal Anti-Rorc Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Rorc antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VKFGRMSKKQRDSLHAEVQKQLQQQQQQEQVAKTPPAGSRGADTLTYTLG |
RORC Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 120-320 of human RORC (NP_005051.2). |
Modifications | Unmodified |