USD 515.00
In Stock
Rabbit Monoclonal antibody against KLKB1
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 515.00
In Stock
Rabbit Monoclonal antibody against KLKB1
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti-KLKB1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human KLKB1 |
Rabbit polyclonal KLKB1 (heavy chain, Cleaved-Arg390) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human KLKB1.Purification: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen. |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-KLKB1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KLKB1 antibody: synthetic peptide directed towards the middle region of human KLKB1. Synthetic peptide located within the following region: VLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVS |
KLKB1 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-300 of human KLKB1 (NP_000883.2). |
Modifications | Unmodified |