Antibodies

View as table Download

Rabbit anti-E2F6 Polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human E2F6

Rabbit Polyclonal Anti-E2F6 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-E2F6 Antibody: A synthesized peptide derived from human E2F6

Anti-E2F6 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit Polyclonal Anti-E2F6 Antibody

Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-E2f6 antibody is: synthetic peptide directed towards the middle region of Rat E2f6. Synthetic peptide located within the following region: RRVYDITNVLDGIELVEKKSKNHIRWIGSDLNNFGAAPQQKKLQAELSDL