Antibodies

View as table Download

PDK1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PDK1

PDK1 rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Canine, Human, Monkey, Mouse, Porcine, Rabbit, Rat
Immunogen Fusion protein containing amino acids 269-320 from human m1 AChR.

Rabbit Polyclonal Antibody against PDK1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-Terminal portion of the human PDK1 protein sequence (between residues 350-436). [Swiss-Prot Q15118]

Rabbit polyclonal PDK1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PDK1.

Rabbit Polyclonal Antibody against PDK1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human PDK1 protein sequence (between residues 300-400). [Swiss-Prot Q15118]

Rabbit Polyclonal anti-PDK1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PDK1 antibody: synthetic peptide directed towards the middle region of human PDK1. Synthetic peptide located within the following region: ATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMY

PDK1 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle terminal region of mouse PDK1

PDK1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PDK1

PDK1/PDHK1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human PDK1/PDHK1 (NP_002601.1).
Modifications Unmodified