Angpt2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence mapping near the C-terminal (454-468) of Human Angiopoietin-2. |
Angpt2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence mapping near the C-terminal (454-468) of Human Angiopoietin-2. |
Rabbit Polyclonal Anti-ANGPT2 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Angpt2 antibody is: synthetic peptide directed towards the middle region of Mouse Angpt2. Synthetic peptide located within the following region: NQTTRLELQLLQHSISTNKLEKQILDQTSEINKLQNKNSFLEQKVLDMEG |
Rabbit anti-ANGPT2 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ANGPT2 |
Rabbit Polyclonal Anti-ANG 2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANG 2 Antibody: A synthesized peptide derived from human ANG 2 |
Angiopoietin 2 (ANGPT2) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 409-440 amino acids from the C-terminal region of human ANGPT2 |
Rabbit Polyclonal ANGPT2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ANGPT2 antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human ANGPT2. |
Rabbit polyclonal Angiopoietin 2 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This whole rabbit serum was prepared by repeated immunizations with a synthetic peptide, corresponding to a region near the N-terminus of mouse angiopoietin-2 protein, conjugated to KLH using maleimide. |
Anti-ANGPT2 rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human angiopoietin 2 |
Anti-ANGPT2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human angiopoietin 2 |
ANGPT2 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ANGPT2 |