Rabbit Polyclonal ASH2 Antibody
| Applications | ELISA, IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASH2 antibody: mouse Ash2 (absent, small, or homeotic 2), using 3 different KLH-conjugated synthetic peptides, 2 containing an amino acid sequence from the central and 1 containing an amino acid sequence from the C-terminal part of |
Rabbit Polyclonal Anti-ASH2L Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASH2L antibody: synthetic peptide directed towards the N terminal of human ASH2L. Synthetic peptide located within the following region: AAGAAAPPGEGISAAPTVEPSSGEAEGGEANLVDVSGGLETESSNGKDTL |
Rabbit Polyclonal ASH2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASH2 antibody: human Ash2 (absent, small, or homeotic 2), using a recombinant protein. |
Rabbit Polyclonal ASH2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASH2 antibody: human Ash2 (absent, small, or homeotic 2), using a recombinant protein. |
Rabbit Polyclonal Anti-ASH2L Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ASH2L Antibody: synthetic peptide directed towards the middle region of human ASH2L. Synthetic peptide located within the following region: AAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFN |
Rabbit Polyclonal Anti-ASH2L Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ASH2L Antibody: synthetic peptide directed towards the N terminal of human ASH2L. Synthetic peptide located within the following region: EPSSGEAEGGEANLVDVSGGLETESSNGKDTLEGAGDTSEVMDTQAGSVD |
Rabbit Polyclonal Anti-ASH2L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ASH2L Antibody: synthetic peptide directed towards the N terminal of human ASH2L. Synthetic peptide located within the following region: EPSSGEAEGGEANLVDVSGGLETESSNGKDTLEGAGDTSEVMDTQAGSVD |
Rabbit Polyclonal Anti-ASH2L Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ASH2L |
ASH2L rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ASH2L |
ASH2L Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 81-280 of human ASH2L (NP_001098684.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
