Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit anti-HDAC6 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HDAC6 |
Rabbit Polyclonal Anti-HDAC6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HDAC6 Antibody: A synthesized peptide derived from human HDAC6 |
Rabbit Polyclonal Anti-HDAC6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HDAC6 Antibody: A synthesized peptide derived from human HDAC6 |
Rabbit Polyclonal HDAC6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human HDAC6 |
Rabbit Polyclonal Anti-Hdac6 Antibody
| Applications | Assay, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Hdac6 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hdac6. Synthetic peptide located within the following region: VCHHEASEHPLVLSCVDLSTWCYVCQAYVHHEDLQDVKNAAHQNKFGEDM |
Rabbit Polyclonal HDAC6 (Ser22) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human HDAC6 around the phosphorylation site of Serine 22 |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-HDAC6 antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HDAC6 antibody: synthetic peptide directed towards the N terminal of human HDAC6. Synthetic peptide located within the following region: VGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQ |
Rabbit Polyclonal HDAC6 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the human HDAC6 protein (between residues 1175-1215) [UniProt Q9UBN7] |
HDAC6 Rabbit polyclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 836-1104 of human HDAC6 (NP_006035.2). |
| Modifications | Unmodified |
HDAC6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 836-1104 of human HDAC6 (NP_006035.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- HDAC6
Antibody Hosts
- Rabbit