Antibodies

Jump to Filters
View as table Download
HPRT (HPRT1) Rabbit Polyclonal Antibody
TA308902

USD 415.00

In Stock

Rabbit Polyclonal antibody to HPRT (hypoxanthine phosphoribosyltransferase 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 23 and 218 of HPRT (Uniprot ID#P00492)
HPRT (HPRT1) Rabbit Polyclonal Antibody
TA308901

USD 415.00

In Stock

Rabbit Polyclonal antibody to HPRT (hypoxanthine phosphoribosyltransferase 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 218 of HPRT (Uniprot ID#P00492)
HPRT (HPRT1) Rabbit Polyclonal Antibody
TA332846

USD 374.00

3 Weeks

Rabbit anti-HPRT1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HPRT1
HPRT (HPRT1) Rabbit Polyclonal Antibody
TA346669

USD 475.00

5 Days

Rabbit Polyclonal Anti-HPRT1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HPRT1 antibody: synthetic peptide directed towards the middle region of human HPRT1. Synthetic peptide located within the following region: STGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVK
HPRT (HPRT1) (C-term) Rabbit Polyclonal Antibody
AP17483PU-N

USD 450.00

2 Weeks

HPRT (HPRT1) (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human HPRT1
HPRT (HPRT1) Rabbit Polyclonal Antibody
TA384448

USD 380.00

4 Weeks

HPRT Rabbit polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human HPRT