Antibodies

View as table Download

KRT8/CK8 mouse monoclonal antibody, clone UMAB1

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Purified CD20 (MS4A1) mouse monoclonal antibody,clone UMAB58

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Carrier-free (BSA/glycerol-free) anti-ERCC1 mouse monoclonal antibody, clone 4F9

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit Polyclonal Anti-PRMT3 Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRMT3 antibody: synthetic peptide directed towards the middle region of human PRMT3. Synthetic peptide located within the following region: LEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWK

Rabbit Polyclonal Anti-PRMT6 Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRMT6 antibody: synthetic peptide directed towards the middle region of human PRMT6. Synthetic peptide located within the following region: FRCSCYGSAPMHGFAIWFQVTFPGGESEKPLVLSTSPFHPATHWKQALLY

Rabbit Polyclonal Anti-TAF2 Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAF2 Antibody: synthetic peptide directed towards the middle region of human TAF2. Synthetic peptide located within the following region: RKRNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKH

Rabbit Polyclonal Anti-TAF4 Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAF4 Antibody: synthetic peptide directed towards the middle region of human TAF4. Synthetic peptide located within the following region: EQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRL

Rabbit Polyclonal Anti-THRB Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-THRB antibody: synthetic peptide directed towards the N terminal of human THRB. Synthetic peptide located within the following region: MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLK

Rabbit Polyclonal Anti-Suv420h1

Applications 10k-ChIP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen . Synthetic peptide located within the following region: FINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFC

Rabbit Polyclonal Anti-HIST1H1C Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HIST1H1C antibody: synthetic peptide directed towards the middle region of human HIST1H1C. Synthetic peptide located within the following region: ASGSFKLNKKAASGEAKPKVKKAGGTKPKKPVGAAKKPKKAAGGATPKKS

Rabbit Polyclonal Anti-SMYD2 Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMYD2 antibody: synthetic peptide directed towards the middle region of human SMYD2. Synthetic peptide located within the following region: SMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES

Rabbit Polyclonal Anti-SMYD3 Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMYD3 antibody: synthetic peptide directed towards the N terminal of human SMYD3. Synthetic peptide located within the following region: PRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDKKEGL

Rabbit Polyclonal Anti-MED25 Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MED25 antibody: synthetic peptide directed towards the N terminal of human MED25. Synthetic peptide located within the following region: EGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCAPESYV

Rabbit Polyclonal Anti-MED25 Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MED25 antibody is: synthetic peptide directed towards the C-terminal region of Human MED25. Synthetic peptide located within the following region: PPLLHPPPAQSWPAQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDI

Carrier-free (BSA/glycerol-free) KRT8/CK8 mouse monoclonal antibody, clone UMAB1

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

KRT19/CK19 mouse monoclonal antibody,clone UMAB3

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Dog
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Carrier-free (BSA/glycerol-free) KRT19/CK19 mouse monoclonal antibody,clone UMAB3

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Dog
Conjugation Unconjugated

Anti-CD2 mouse monoclonal antibody,clone UMAB6

Applications 10k-ChIP, FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Carrier-free (BSA/glycerol-free) anti-CD2 mouse monoclonal antibody,clone UMAB6

Applications 10k-ChIP, FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-ERCC1 mouse monoclonal antibody, clone 4F9

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Anti-HP mouse monoclonal antibody, clone UMAB10

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Carrier-free (BSA/glycerol-free) anti-HP mouse monoclonal antibody, clone UMAB10

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

ERCC1 mouse monoclonal antibody, clone 2E12

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Carrier-free (BSA/glycerol-free) ERCC1 mouse monoclonal antibody, clone 2E12

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

SQSTM1 mouse monoclonal antibody, clone UMAB13

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Carrier-free (BSA/glycerol-free) SQSTM1 mouse monoclonal antibody, clone UMAB13

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Beta-Catenin (CTNNB1) mouse monoclonal antibody, clone UMAB14

Applications 10k-ChIP, FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Carrier-free (BSA/glycerol-free) Beta-Catenin (CTNNB1) mouse monoclonal antibody, clone UMAB14

Applications 10k-ChIP, FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Beta-Catenin (CTNNB1) mouse monoclonal antibody, clone UMAB15

Applications 10k-ChIP, FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Carrier-free (BSA/glycerol-free) Beta-Catenin (CTNNB1) mouse monoclonal antibody, clone UMAB15

Applications 10k-ChIP, FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

SERPINB4 mouse monoclonal antibody, clone UMAB16

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Carrier-free (BSA/glycerol-free) SERPINB4 mouse monoclonal antibody, clone UMAB16

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

XPF mouse monoclonal antibody,clone UMAB20

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Carrier-free (BSA/glycerol-free) XPF mouse monoclonal antibody,clone UMAB20

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

XPF mouse monoclonal antibody,clone UMAB21

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Carrier-free (BSA/glycerol-free) XPF mouse monoclonal antibody,clone UMAB21

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

XPF mouse monoclonal antibody,clone UMAB22

Applications 10k-ChIP, IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Carrier-free (BSA/glycerol-free) XPF mouse monoclonal antibody,clone UMAB22

Applications 10k-ChIP, IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated

S100P mouse monoclonal antibody,clone UMAB24

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Carrier-free (BSA/glycerol-free) S100P mouse monoclonal antibody,clone UMAB24

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

FOLH1 mouse monoclonal antibody,clone UMAB25

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Carrier-free (BSA/glycerol-free) FOLH1 mouse monoclonal antibody,clone UMAB25

Applications 10k-ChIP, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

FOLH1 mouse monoclonal antibody,clone UMAB26

Applications 10k-ChIP, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Carrier-free (BSA/glycerol-free) FOLH1 mouse monoclonal antibody,clone UMAB26

Applications 10k-ChIP, IHC, WB
Reactivities Human
Conjugation Unconjugated

PECAM1 mouse monoclonal antibody,clone UMAB29

Applications 10k-ChIP, FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Carrier-free (BSA/glycerol-free) PECAM1 mouse monoclonal antibody,clone UMAB29

Applications 10k-ChIP, FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

PECAM1 mouse monoclonal antibody,clone UMAB30

Applications 10k-ChIP, FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Carrier-free (BSA/glycerol-free) PECAM1 mouse monoclonal antibody,clone UMAB30

Applications 10k-ChIP, FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

PECAM1 mouse monoclonal antibody,clone UMAB32

Applications 10k-ChIP, FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Carrier-free (BSA/glycerol-free) PECAM1 mouse monoclonal antibody,clone UMAB32

Applications 10k-ChIP, FC, IHC, WB
Reactivities Human
Conjugation Unconjugated