Antibodies

Jump to Filters
View as table Download
SMYD2 Rabbit Polyclonal Antibody
TA339738

USD 375.00

5 Days

Rabbit Polyclonal Anti-SMYD2 Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMYD2 antibody: synthetic peptide directed towards the middle region of human SMYD2. Synthetic peptide located within the following region: SMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES