KRT8/CK8 mouse monoclonal antibody, clone UMAB1
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
KRT8/CK8 mouse monoclonal antibody, clone UMAB1
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Purified CD20 (MS4A1) mouse monoclonal antibody,clone UMAB58
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) anti-ERCC1 mouse monoclonal antibody, clone 4F9
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PRMT3 Antibody
Applications | 10k-ChIP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRMT3 antibody: synthetic peptide directed towards the middle region of human PRMT3. Synthetic peptide located within the following region: LEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWK |
Rabbit Polyclonal Anti-PRMT6 Antibody
Applications | 10k-ChIP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRMT6 antibody: synthetic peptide directed towards the middle region of human PRMT6. Synthetic peptide located within the following region: FRCSCYGSAPMHGFAIWFQVTFPGGESEKPLVLSTSPFHPATHWKQALLY |
Rabbit Polyclonal Anti-TAF2 Antibody
Applications | 10k-ChIP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TAF2 Antibody: synthetic peptide directed towards the middle region of human TAF2. Synthetic peptide located within the following region: RKRNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKH |
Rabbit Polyclonal Anti-TAF4 Antibody
Applications | 10k-ChIP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TAF4 Antibody: synthetic peptide directed towards the middle region of human TAF4. Synthetic peptide located within the following region: EQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKSRSRQEDPEQLRL |
Rabbit Polyclonal Anti-THRB Antibody
Applications | 10k-ChIP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-THRB antibody: synthetic peptide directed towards the N terminal of human THRB. Synthetic peptide located within the following region: MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLK |
Rabbit Polyclonal Anti-Suv420h1
Applications | 10k-ChIP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | . Synthetic peptide located within the following region: FINHDCRPNCKFVSTGRDTACVKALRDIEPGEEISCYYGDGFFGENNEFC |
Rabbit Polyclonal Anti-HIST1H1C Antibody
Applications | 10k-ChIP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HIST1H1C antibody: synthetic peptide directed towards the middle region of human HIST1H1C. Synthetic peptide located within the following region: ASGSFKLNKKAASGEAKPKVKKAGGTKPKKPVGAAKKPKKAAGGATPKKS |
Rabbit Polyclonal Anti-SMYD2 Antibody
Applications | 10k-ChIP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SMYD2 antibody: synthetic peptide directed towards the middle region of human SMYD2. Synthetic peptide located within the following region: SMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES |
Rabbit Polyclonal Anti-SMYD3 Antibody
Applications | 10k-ChIP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SMYD3 antibody: synthetic peptide directed towards the N terminal of human SMYD3. Synthetic peptide located within the following region: PRYPPDSVRLLGRVVFKLMDGAPSESEKLYSFYDLESNINKLTEDKKEGL |
Rabbit Polyclonal Anti-MED25 Antibody
Applications | 10k-ChIP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MED25 antibody: synthetic peptide directed towards the N terminal of human MED25. Synthetic peptide located within the following region: EGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCAPESYV |
Rabbit Polyclonal Anti-MED25 Antibody
Applications | 10k-ChIP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-MED25 antibody is: synthetic peptide directed towards the C-terminal region of Human MED25. Synthetic peptide located within the following region: PPLLHPPPAQSWPAQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDI |
Carrier-free (BSA/glycerol-free) KRT8/CK8 mouse monoclonal antibody, clone UMAB1
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
KRT19/CK19 mouse monoclonal antibody,clone UMAB3
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRT19/CK19 mouse monoclonal antibody,clone UMAB3
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
Anti-CD2 mouse monoclonal antibody,clone UMAB6
Applications | 10k-ChIP, FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) anti-CD2 mouse monoclonal antibody,clone UMAB6
Applications | 10k-ChIP, FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-ERCC1 mouse monoclonal antibody, clone 4F9
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Anti-HP mouse monoclonal antibody, clone UMAB10
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) anti-HP mouse monoclonal antibody, clone UMAB10
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ERCC1 mouse monoclonal antibody, clone 2E12
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ERCC1 mouse monoclonal antibody, clone 2E12
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
SQSTM1 mouse monoclonal antibody, clone UMAB13
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SQSTM1 mouse monoclonal antibody, clone UMAB13
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Beta-Catenin (CTNNB1) mouse monoclonal antibody, clone UMAB14
Applications | 10k-ChIP, FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) Beta-Catenin (CTNNB1) mouse monoclonal antibody, clone UMAB14
Applications | 10k-ChIP, FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Beta-Catenin (CTNNB1) mouse monoclonal antibody, clone UMAB15
Applications | 10k-ChIP, FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) Beta-Catenin (CTNNB1) mouse monoclonal antibody, clone UMAB15
Applications | 10k-ChIP, FC, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
SERPINB4 mouse monoclonal antibody, clone UMAB16
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SERPINB4 mouse monoclonal antibody, clone UMAB16
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
XPF mouse monoclonal antibody,clone UMAB20
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) XPF mouse monoclonal antibody,clone UMAB20
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
XPF mouse monoclonal antibody,clone UMAB21
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) XPF mouse monoclonal antibody,clone UMAB21
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
XPF mouse monoclonal antibody,clone UMAB22
Applications | 10k-ChIP, IF, IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) XPF mouse monoclonal antibody,clone UMAB22
Applications | 10k-ChIP, IF, IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
S100P mouse monoclonal antibody,clone UMAB24
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) S100P mouse monoclonal antibody,clone UMAB24
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
FOLH1 mouse monoclonal antibody,clone UMAB25
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FOLH1 mouse monoclonal antibody,clone UMAB25
Applications | 10k-ChIP, IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
FOLH1 mouse monoclonal antibody,clone UMAB26
Applications | 10k-ChIP, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FOLH1 mouse monoclonal antibody,clone UMAB26
Applications | 10k-ChIP, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PECAM1 mouse monoclonal antibody,clone UMAB29
Applications | 10k-ChIP, FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PECAM1 mouse monoclonal antibody,clone UMAB29
Applications | 10k-ChIP, FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PECAM1 mouse monoclonal antibody,clone UMAB30
Applications | 10k-ChIP, FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PECAM1 mouse monoclonal antibody,clone UMAB30
Applications | 10k-ChIP, FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PECAM1 mouse monoclonal antibody,clone UMAB32
Applications | 10k-ChIP, FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PECAM1 mouse monoclonal antibody,clone UMAB32
Applications | 10k-ChIP, FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |