Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
| Applications | Assay, FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
SKP1 (C-term) rabbit polyclonal antibody, Serum
| Applications | Assay, ELISA, IP, WB |
| Reactivities | Human |
| Immunogen | Prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 152-163 of Human SKP1 (C-terminus) coupled to KLH. |
Rabbit Polyclonal anti-TP53 antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal anti-TP53 antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal Anti-JUN Antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-JUN antibody: synthetic peptide directed towards the N terminal of human JUN. Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP |
Rabbit polyclonal Anti-PRKCG Antibody
| Applications | Assay, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKCG antibody: synthetic peptide directed towards the N terminal of human PRKCG. Synthetic peptide located within the following region: FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL |
Rabbit Polyclonal Anti-CTNNB1 Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTNNB1 antibody: synthetic peptide directed towards the middle region of human CTNNB1. Synthetic peptide located within the following region: RTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDP |
Rabbit Polyclonal Anti-CTNNB1 Antibody
| Applications | Assay, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CTNNB1 antibody is: synthetic peptide directed towards the C-terminal region of Human CTNNB1. Synthetic peptide located within the following region: LGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPG |
Active filters
Applications
- Assay
Pathways
- Wnt signaling pathway
Filter by
Category
Reactivities
Antibody Hosts
Isotypes
Clonalities
Conjugates
Families
- Druggable Genome (12)
- Transcription Factors (9)
- Stem cell - Pluripotency (7)
- ES Cell Differentiation/IPS (3)
- Stem cell relevant signaling - JAK/STAT signaling pathway (2)
- Stem cell relevant signaling - Wnt Signaling pathway (2)
- Embryonic stem cells (1)
- Induced pluripotent stem cells (1)
- Protein Kinase (1)
- Stem cell relevant signaling - DSL/Notch pathway (1)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (1)