Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal FGFR2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal IGF1 Receptor Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal MDM2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal MDM2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal MDM2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal PDGFB Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal PDGF Receptor beta Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal PDPK1 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal EGFR Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal IKB alpha Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Bcl2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
USD 530.00
2 Weeks
EGFR pThr693 (incl. pos. control) mouse monoclonal antibody, clone 5F10, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 465.00
2 Weeks
ERK2 (MAPK1) (N-term) (incl. pos. control) mouse monoclonal antibody, clone 6H3, Biotin
| Applications | ELISA, WB |
| Reactivities | Canine, Human, Mouse, Rat |
| Conjugation | Biotin |
USD 465.00
2 Weeks
MEK1 (MAP2K1) (incl. pos. control) mouse monoclonal antibody, clone 9G3, Purified
| Applications | ELISA, WB |
| Reactivities | Canine, Human, Mouse, Rat |
p21 Ras (HRAS) mouse monoclonal antibody, clone H-Ras-03, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
RAF1 (N-term) mouse monoclonal antibody, clone 540, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
RAF1 (N-term) mouse monoclonal antibody, clone 863, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
RAF1 (N-term) mouse monoclonal antibody, clone 163, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
EGFR rabbit polyclonal antibody, Purified
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to amino acids 1189-1199 of human EGF receptor protein. |
EGFR rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure recombinant Human EGFR. |
EGFR rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure recombinant Human EGFR. |
EGFR rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Immunogen | Highly pure recombinant Human EGFR. |
EGFR rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Immunogen | Highly pure recombinant Human EGFR. |
USD 475.00
2 Weeks
Prostate Specific Antigen (KLK3) mouse monoclonal antibody, clone CHYH2, HRP
| Applications | ELISA, IHC |
| Reactivities | Human |
| Conjugation | HRP |
Her2 (ERBB2) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, WB |
| Reactivities | Human |
| Immunogen | Recombinant Human Herstatin. The immunization antigen (43.4 kda) is a protein containing 397 AA of recombinant Human Herstatin and one extra AA, N-terminal methionin (highlighted) |
IGF1 rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | E.coli derived recombinant Human IGF-I (Cat.-No PA071) |
IGF1 rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | E.coli derived recombinant Human IGF-I (Cat.-No PA071) |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
USD 379.00
2 Weeks
Active filters
Applications
- ELISA
Pathways
- Prostate cancer
Filter by
Category
Target Symbol
- EGFR (24)
- EGF (21)
- BRAF (19)
- KLK3 (11)
- MAP2K1 (11)
- INS (10)
- FGFR2 (9)
- AKT1 (7)
- IGF1 (7)
- PDGFB (7)
- AKT2 (6)
- MAPK1 (6)
- PDGFA (6)
- CREB1 (5)
- HSP90B1 (5)
- CTNNB1 (4)
- GSTP1 (4)
- MDM2 (4)
- RAF1 (4)
- TP53 (4)
- BCL2 (3)
- EP300 (3)
- NRAS (3)
- CASP9 (2)
- CDKN1A (2)
- ERBB2 (2)
- FGFR1 (2)
- HSP90AA1 (2)
- KRAS (2)
- MAPK3 (2)
- PDPK1 (2)
- AKT3 (1)
- ATF4 (1)
- CCND1 (1)
- CCNE2 (1)
- CDKN1B (1)
- CREBBP (1)
- E2F1 (1)
- E2F2 (1)
- FOXO1 (1)
- GRB2 (1)
- HRAS (1)
- IGF1R (1)
- IKBKG (1)
- MTOR (1)
- NFKB1 (1)
- NFKBIA (1)
- NKX3-1 (1)
- PDGFRB (1)
- SOS1 (1)
- TGFA (1)
Reactivities
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Assay Types
Assay Platforms
Families
- Druggable Genome (218)
- Protein Kinase (98)
- ES Cell Differentiation/IPS (86)
- Transmembrane (64)
- Secreted Protein (62)
- Adult stem cells (45)
- Transcription Factors (27)
- Stem cell relevant signaling - JAK/STAT signaling pathway (25)
- Cancer stem cells (24)
- Embryonic stem cells (21)
- Induced pluripotent stem cells (21)
- Protease (13)
- Stem cell - Pluripotency (10)
- Stem cell relevant signaling - DSL/Notch pathway (1)
- Stem cell relevant signaling - Wnt Signaling pathway (1)