Rabbit Polyclonal CXCR4 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4. |
Rabbit Polyclonal CCR5 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CCR5 antibody was raised against a 15 amino acid peptide near the amino terminus of human CCR5. The immunogen is located within the first 50 amino acids of CCR5. |
Rabbit polyclonal PDGFR beta (Ab-1021) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PDGFR β around the phosphorylation site of tyrosine 1021 (N-D-YP-I-I). |
Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human: Thr693, Mouse: Thr695, Rat: Thr694 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal IL-7R/CD127 (Tyr449) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-7R/CD127 around the phosphorylation site of tyrosine 449 (E-A-YP-V-T). |
| Modifications | Phospho-specific |
Rabbit polyclonal PDGFRB Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PDGFRB antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 40-72 amino acids from the N-terminal region of human PDGFRB. |
Rabbit Polyclonal CXCR4 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CXCR4 antibody was raised against a 15 amino acid peptide near the center of human CXCR4. The immunogen is located within amino acids 170 - 220 of CXCR4. |
Rabbit polyclonal anti-GPR42 antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR42. |
Rabbit polyclonal EGFR (Thr678) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 678 (K-R-TP-L-R). |
| Modifications | Phospho-specific |
Rabbit polyclonal IL-2Ra/CD25 (Ser268) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-2Ra/CD25 around the phosphorylation site of serine 268 (R-K-SP-R-R). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CSF1 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSF1 antibody: synthetic peptide directed towards the middle region of human CSF1. Synthetic peptide located within the following region: MAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPP |
Rabbit Polyclonal Anti-CSF1 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSF1 antibody: synthetic peptide directed towards the middle region of human CSF1. Synthetic peptide located within the following region: SGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTG |
Rabbit anti-FLT3 polyclonal antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized non-phosphopeptide derived fromhuman FLT3 around the phosphorylation site of tyrosine 591 (Y-F-YP-V-D). |
Germany
Japan
United Kingdom
China
