Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014) |
Rabbit polyclonal antibody to Factor XIIIa (coagulation factor XIII, A1 polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 258 of Factor XIIIa (Uniprot ID#P00488) |
Rabbit Polyclonal MUC-1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit polyclonal antibody to WNT10A (wingless-type MMTV integration site family, member 10A)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 47 and 271 of WNT10A (Uniprot ID#Q9GZT5) |
Rabbit Polyclonal anti-CALR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH |
Rabbit polyclonal IGFBP2 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IGFBP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-305 amino acids from the C-terminal region of human IGFBP2. |
Rabbit Polyclonal antibody to SNTB2 (syntrophin, beta 2 (dystrophin-associated protein A1, 59kDa, basic component 2))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 174 and 540 of SNTB2 (Uniprot ID#Q13425) |
Rabbit Polyclonal antibody to alpha 2 Antiplasmin (serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 2)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 188 and 453 of alpha 2 Antiplasmin (Uniprot ID#P08697) |
Insulin (INS) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Bovine, Porcine, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal antibody to Cartilage-associated protein (cartilage associated protein)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 122 and 363 of Cartilage-associated protein (Uniprot ID#O75718) |
Rabbit Polyclonal Apolipoprotein E R2/ApoE R2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Bovine, Chicken |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the human ApoER2 protein sequence (between residues 800-900). [UniProt# Q14114] |
Active filters
Reactivities
- Bovine
Applications
- IF
Families
- Secreted Protein
Filter by
Category
Target Symbol
Antibody Hosts
Isotypes
Clonalities
Conjugates
Pathways
- Complement and coagulation cascades (3)
- Antigen processing and presentation (2)
- Basal cell carcinoma (2)
- Hedgehog signaling pathway (2)
- Melanogenesis (2)
- Pathways in cancer (2)
- Wnt signaling pathway (2)
- Cytokine-cytokine receptor interaction (1)
- Glycerolipid metabolism (1)
- Insulin signaling pathway (1)
- Maturity onset diabetes of the young (1)
- Metabolic pathways (1)
- Oocyte meiosis (1)
- Progesterone-mediated oocyte maturation (1)
- Prostate cancer (1)
- Regulation of actin cytoskeleton (1)
- Regulation of autophagy (1)
- Systemic lupus erythematosus (1)
- TGF-beta signaling pathway (1)
- Type I diabetes mellitus (1)
- Type II diabetes mellitus (1)
- mTOR signaling pathway (1)