Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Hsp70 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Beluga, Cow, Dog, Fish (carp), Guinea Pig, Hamster, Monkey, Pig, Sheep, Coral, Tomato, Tobacco, Spiny Dogfish Shark (Squalus acanthias), Atlantic Hagfish (Myxine glutinosa) |
| Conjugation | Unconjugated |
| Immunogen | Full length human protein Hsp70 |
Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348) |
Rabbit Polyclonal MUC-1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal anti-CALR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
Rabbit Polyclonal anti-UBB Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Hamster, Rabbit, Guinea Porcine, Bovine, Porcine, Dog, Sheep, Chicken, Xenopus, Drosophila |
| Conjugation | Unconjugated |
| Immunogen | Native bovine Ubiquitin, conjugated to KLH |
Mouse monoclonal HSF1 Antibody
| Applications | IF |
| Reactivities | Bovine, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
Recombinant Anti-SNAP-25 (Clone SP12)
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Feline, Guinea Pig, Hamster, Human, Mouse, Rat, Pig, Cow |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Active filters
Reactivities
- Guinea Pig
Applications
- IF
Filter by
Category
Target Symbol
Antibody Hosts
Clonalities
Conjugates
Assay Types
Families
Pathways
- Antigen processing and presentation (6)
- Endocytosis (3)
- MAPK signaling pathway (3)
- Spliceosome (3)
- Calcium signaling pathway (2)
- Neuroactive ligand-receptor interaction (2)
- Prion diseases (2)
- Adherens junction (1)
- Adipocytokine signaling pathway (1)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (1)
- Dilated cardiomyopathy (1)
- Focal adhesion (1)
- Hypertrophic cardiomyopathy (HCM) (1)
- Leukocyte transendothelial migration (1)
- Parkinson's disease (1)
- Pathogenic Escherichia coli infection (1)
- Regulation of actin cytoskeleton (1)
- Tight junction (1)
- Vascular smooth muscle contraction (1)
- Vibrio cholerae infection (1)
- Viral myocarditis (1)