Antibodies

Jump to Filters
View as table Download
ADH5 Rabbit Polyclonal Antibody
TA327239

USD 275.00

3 Weeks

Rabbit anti-ADH5 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ADH5
GAPDH Goat Polyclonal Antibody
TA302944

USD 375.00

2 Weeks

Goat polyclonal anti-GAPDH antibody(C-terminal), Loading control

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-HQVVSSDFNSDT, from the C Terminus of the protein sequence according to NP_002037.2.
glucose 6 phosphatase, catalytic subunit (G6PC) Rabbit Polyclonal Antibody
TA334652

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-G6PC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM
GAPDH Rabbit Polyclonal Antibody
TA308884

USD 415.00

2 Weeks

Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406)