Antibodies

Jump to Filters
View as table Download
BHMT Rabbit Polyclonal Antibody
TA346077

USD 410.00

5 Days

Rabbit Polyclonal Anti-BHMT Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-BHMT antibody: synthetic peptide directed towards the N terminal of human BHMT. Synthetic peptide located within the following region: AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE
BHMT Rabbit Polyclonal Antibody
TA346078

USD 410.00

5 Days

Rabbit Polyclonal Anti-BHMT Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-BHMT antibody: synthetic peptide directed towards the C terminal of human BHMT. Synthetic peptide located within the following region: KHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVT
BHMT (391-402) Goat Polyclonal Antibody
AP22552PU-N

USD 440.00

2 Weeks

BHMT (391-402) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Hamster, Human, Monkey, Rat
Immunogen Synthetic peptide from C-term of human BHMT
BHMT Rabbit Polyclonal Antibody
TA308186

USD 415.00

5 Days

Rabbit Polyclonal antibody to BHMT (betaine-homocysteine methyltransferase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 199 and 406 of BHMT (Uniprot ID#Q93088)
BHMT Rabbit Polyclonal Antibody
TA308187

USD 415.00

5 Days

Rabbit Polyclonal antibody to BHMT (betaine-homocysteine methyltransferase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 243 of BHMT (Uniprot ID#Q93088)