Antibodies

View as table Download

Rabbit Polyclonal Anti-PPP1R8 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP1R8 antibody: synthetic peptide directed towards the N terminal of human PPP1R8. Synthetic peptide located within the following region: THGTFLGHIRLEPHKPQQIPIDSTVSFGASTRAYTLREKPQTLPSAVKGD

Rabbit Polyclonal Anti-PPP1R8 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP1R8 antibody: synthetic peptide directed towards the middle region of human PPP1R8. Synthetic peptide located within the following region: PNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKK

Carrier-free (BSA/glycerol-free) PPP1R8 mouse monoclonal antibody, clone OTI2E12 (formerly 2E12)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PPP1R8 mouse monoclonal antibody, clone OTI4D5 (formerly 4D5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PPP1R8 mouse monoclonal antibody, clone OTI4E5 (formerly 4E5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PPP1R8 mouse monoclonal antibody, clone OTI5H9 (formerly 5H9)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP1R8 mouse monoclonal antibody, clone OTI2E12 (formerly 2E12)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP1R8 mouse monoclonal antibody, clone OTI2E12 (formerly 2E12)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PPP1R8 mouse monoclonal antibody, clone OTI4D5 (formerly 4D5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP1R8 mouse monoclonal antibody, clone OTI4D5 (formerly 4D5), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PPP1R8 mouse monoclonal antibody, clone OTI4D5 (formerly 4D5), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PPP1R8 mouse monoclonal antibody, clone OTI4D5 (formerly 4D5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PPP1R8 mouse monoclonal antibody, clone OTI4E5 (formerly 4E5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP1R8 mouse monoclonal antibody, clone OTI4E5 (formerly 4E5), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PPP1R8 mouse monoclonal antibody, clone OTI4E5 (formerly 4E5), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

PPP1R8 mouse monoclonal antibody, clone OTI4E5 (formerly 4E5)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PPP1R8 mouse monoclonal antibody, clone OTI5H9 (formerly 5H9)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP1R8 mouse monoclonal antibody, clone OTI5H9 (formerly 5H9), Biotinylated

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Biotin

PPP1R8 mouse monoclonal antibody, clone OTI5H9 (formerly 5H9), HRP conjugated

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation HRP

PPP1R8 mouse monoclonal antibody, clone OTI5H9 (formerly 5H9)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".