Antibodies

View as table Download

Rabbit Polyclonal Anti-MSH2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MSH2 antibody: synthetic peptide directed towards the N terminal of human MSH2. Synthetic peptide located within the following region: GNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDG

Rabbit polyclonal anti-MSH2 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MSH2.

Carrier-free (BSA/glycerol-free) MSH2 mouse monoclonal antibody, clone OTI10F7

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Mouse Monoclonal MSH2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

MSH2 mouse monoclonal antibody, clone OTI10F7

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MSH2 mouse monoclonal antibody, clone OTI10F7, Biotinylated

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Biotin

MSH2 mouse monoclonal antibody, clone OTI10F7, HRP conjugated

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation HRP

MSH2 mouse monoclonal antibody, clone OTI10F7

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MSH2 mouse monoclonal antibody,clone UMAB259

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) MSH2 mouse monoclonal antibody,clone UMAB259

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MSH2 mouse monoclonal antibody,clone UMAB259

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated