Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 175 results

Page 1 of 4

(reset)

SHMT2 Rabbit Polyclonal Antibody

TA327002

USD 380.00

3 Weeks

Rabbit anti-SHMT2 Polyclonal Antibody

Applications	ICC/IF, IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human SHMT2

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

MTR Goat Polyclonal Antibody

TA302710

USD 375.00

In Stock

Goat Polyclonal Antibody against MTR

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence C-VEKWLGPILGYDTD, from the C Terminus of the protein sequence according to NP_000245.

1 / 2

2 / 2

Previous Next

DHFR Rabbit Monoclonal Antibody [Clone ID: EPR5285]

TA310408

USD 512.00

In Stock

Rabbit Monoclonal antibody against DHFR

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

FTCD Mouse Monoclonal Antibody [Clone ID: 58K-9]

TA336687

USD 424.00

2 Weeks

Mouse Monoclonal 58K Golgi Protein Antibody (58K-9)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat, Bovine, Canine, Chicken
Conjugation	Unconjugated

1 / 3

2 / 3

3 / 3

Previous Next

ALDH1L1 Mouse Monoclonal Antibody [Clone ID: 3E9]

AM31094PU-N

USD 525.00

2 Weeks

ALDH1L1 mouse monoclonal antibody, clone 3E9, Purified

Applications	ELISA, IF, IHC, WB
Reactivities	Human, Mouse

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

FTCD Rabbit Polyclonal Antibody

TA308819

USD 415.00

In Stock

Rabbit Polyclonal antibody to FTCD (formiminotransferase cyclodeaminase)

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 251 of FTCD (Uniprot ID#O95954)

1 / 3

2 / 3

3 / 3

Previous Next

GART Mouse Monoclonal Antibody [Clone ID: 4D6-1D5]

AM20886PU-N

USD 480.00

2 Weeks

GART mouse monoclonal antibody, clone 4D6-1D5

Applications	ELISA, IF, IHC, WB
Reactivities	Human

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

SHMT1 (374-483) Mouse Monoclonal Antibody [Clone ID: 4F9]

AM20941PU-N

USD 480.00

2 Weeks

SHMT1 (374-483) mouse monoclonal antibody, clone 4F9, Purified

Applications	ELISA, IHC, WB
Reactivities	Human

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

ATIC Rabbit Polyclonal Antibody

TA308474

USD 415.00

5 Days

Rabbit polyclonal antibody to ATIC (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 310 and 580 of ATIC (Uniprot ID#P31939)

1 / 3

2 / 3

3 / 3

Previous Next

MTHFD2 Rabbit Polyclonal Antibody

TA324931

USD 450.00

5 Days

Rabbit polyclonal MTHFD2 Antibody (C-term)

Applications	FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This MTHFD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 271-299 amino acids from the C-terminal region of human MTHFD2.

1 / 3

2 / 3

3 / 3

Previous Next

MTHFD1 Rabbit Polyclonal Antibody

TA339293

USD 375.00

5 Days

Rabbit Polyclonal Anti-MTHFD1 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-MTHFD1 antibody: synthetic peptide directed towards the N terminal of human MTHFD1. Synthetic peptide located within the following region: RTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEKD

1 / 2

2 / 2

Previous Next

FTCD Goat Polyclonal Antibody

TA302954

USD 375.00

5 Days

Goat Polyclonal Antibody against FTCD (Internal region)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Peptide with sequence CLREQGRGKDQPGRL, from the internal region of the protein sequence according to NP_006648.1; NP_996848.1.

1 / 2

2 / 2

Previous Next

ATIC Rabbit Polyclonal Antibody

TA339262

USD 310.00

5 Days

Rabbit Polyclonal Anti-ATIC Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-ATIC antibody: synthetic peptide directed towards the middle region of human ATIC. Synthetic peptide located within the following region: RTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYT

1 / 2

2 / 2

Previous Next

SHMT2 Rabbit Polyclonal Antibody

TA339281

USD 310.00

5 Days

Rabbit Polyclonal Anti-SHMT2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the N terminal of human SHMT2. Synthetic peptide located within the following region: ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQR

1 / 2

2 / 2

Previous Next

SHMT2 Rabbit Polyclonal Antibody

TA339282

USD 375.00

5 Days

Rabbit Polyclonal Anti-SHMT2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the C terminal of human SHMT2. Synthetic peptide located within the following region: ELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDE

1 / 2

2 / 2

Previous Next

MTHFD1 Rabbit Polyclonal Antibody

TA339294

USD 375.00

5 Days

Rabbit Polyclonal Anti-MTHFD1 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-MTHFD1 antibody: synthetic peptide directed towards the middle region of human MTHFD1. Synthetic peptide located within the following region: CMAKTHLSLSHNPEQKGVPTGFILPIRDIRASVGAGFLYPLVGTMSTMPG

1 / 2

2 / 2

Previous Next

DHFR Mouse Monoclonal Antibody [Clone ID: OTI3A11]

CF500517

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) DHFR mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

DHFR Mouse Monoclonal Antibody [Clone ID: OTI6G7]

CF500543

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) DHFR mouse monoclonal antibody, clone OTI6G7 (formerly 6G7)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

ALDH1L1 Mouse Monoclonal Antibody [Clone ID: OTI3D2]

CF501850

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI3D2 (formerly 3D2)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ALDH1L1 Mouse Monoclonal Antibody [Clone ID: OTI4C11]

CF501851

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 20

2 / 20

3 / 20

4 / 20

5 / 20

6 / 20

7 / 20

8 / 20

9 / 20

10 / 20

11 / 20

12 / 20

13 / 20

14 / 20

15 / 20

16 / 20

17 / 20

18 / 20

19 / 20

20 / 20

Previous Next

ALDH1L1 Mouse Monoclonal Antibody [Clone ID: OTI3B11]

CF501852

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI3B11 (formerly 3B11)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

ALDH1L1 Mouse Monoclonal Antibody [Clone ID: OTI1H6]

CF501853

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

ALDH1L1 Mouse Monoclonal Antibody [Clone ID: OTI4D5]

CF501854

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI4D5 (formerly 4D5)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

ALDH1L1 Mouse Monoclonal Antibody [Clone ID: OTI5G8]

CF501870

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI5G8 (formerly 5G8)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

ALDH1L1 Mouse Monoclonal Antibody [Clone ID: OTI6A10]

CF501871

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI6A10 (formerly 6A10)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

MTFMT Mouse Monoclonal Antibody [Clone ID: OTI1C1]

CF503547

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) MTFMT mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

MTFMT Mouse Monoclonal Antibody [Clone ID: OTI1E7]

CF503565

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) MTFMT mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

FTCD Mouse Monoclonal Antibody [Clone ID: OTI1A7]

CF504944

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) FTCD mouse monoclonal antibody, clone OTI1A7 (formerly 1A7)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

FTCD Mouse Monoclonal Antibody [Clone ID: OTI4F5]

CF504951

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) FTCD mouse monoclonal antibody, clone OTI4F5 (formerly 4F5)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

FTCD Mouse Monoclonal Antibody [Clone ID: OTI8C2]

CF504981

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) FTCD mouse monoclonal antibody, clone OTI8C2 (formerly 8C2)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

FTCD Mouse Monoclonal Antibody [Clone ID: OTI4A7]

CF505028

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) FTCD mouse monoclonal antibody, clone OTI4A7 (formerly 4A7)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Thymidylate Synthase (TYMS) Mouse Monoclonal Antibody [Clone ID: OTI10F12]

CF801551

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI10F12 (formerly 10F12)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Thymidylate Synthase (TYMS) Mouse Monoclonal Antibody [Clone ID: OTI5H8]

CF801565

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI5H8 (formerly 5H8)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Thymidylate Synthase (TYMS) Mouse Monoclonal Antibody [Clone ID: OTI1B1]

CF801664

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Thymidylate Synthase (TYMS) Mouse Monoclonal Antibody [Clone ID: OTI3F1]

CF801677

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI3F1 (formerly 3F1)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Thymidylate Synthase (TYMS) Mouse Monoclonal Antibody [Clone ID: OTI1A6]

CF801678

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Thymidylate Synthase (TYMS) Mouse Monoclonal Antibody [Clone ID: OTI2C3]

CF801701

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI2C3 (formerly 2C3)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Thymidylate Synthase (TYMS) Mouse Monoclonal Antibody [Clone ID: OTI1D6]

CF801760

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Thymidylate Synthase (TYMS) Mouse Monoclonal Antibody [Clone ID: OTI1A3]

CF801761

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Thymidylate Synthase (TYMS) Mouse Monoclonal Antibody [Clone ID: OTI1B2]

CF801762

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Aminomethyltransferase (AMT) Mouse Monoclonal Antibody [Clone ID: OTI6F4]

CF807784

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) AMT mouse monoclonal antibody, clone OTI6F4 (formerly 6F4)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

SHMT2 Mouse Monoclonal Antibody [Clone ID: OTI1E12]

CF808813

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SHMT2 mouse monoclonal antibody,clone OTI1E12

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

SHMT2 Mouse Monoclonal Antibody [Clone ID: OTI1E6]

CF808814

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SHMT2 mouse monoclonal antibody,clone OTI1E6

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

SHMT2 Mouse Monoclonal Antibody [Clone ID: OTI3E9]

CF808820

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SHMT2 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

ATIC Rabbit Polyclonal Antibody

TA350578

USD 345.00

In Stock

Rabbit Polyclonal Anti-ATIC Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human ATIC

DHFR Mouse Monoclonal Antibody [Clone ID: OTI3A11]

TA500517

USD 379.00

In Stock

Anti-DHFR (Dihydrofolate reductase) mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

DHFR Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A11]

TA500517AM

USD 420.00

5 Days

DHFR mouse monoclonal antibody, Clone 3A11, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

DHFR Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A11]

TA500517BM

USD 420.00

5 Days

DHFR mouse monoclonal antibody, Clone 3A11, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

DHFR Mouse Monoclonal Antibody [Clone ID: OTI3A11]

TA500517S

USD 159.00

2 Days

Anti-DHFR (Dihydrofolate reductase) mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

DHFR Mouse Monoclonal Antibody [Clone ID: OTI6G7]

TA500543

USD 379.00

In Stock

Anti-DHFR (Dihydrofolate reductase) mouse monoclonal antibody, clone OTI6G7 (formerly 6G7)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

1 - 50 of 175 results

Page 1 of 4