Rabbit anti-SHMT2 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SHMT2 |
Rabbit anti-SHMT2 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SHMT2 |
Goat Polyclonal Antibody against MTR
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-VEKWLGPILGYDTD, from the C Terminus of the protein sequence according to NP_000245. |
Rabbit Monoclonal antibody against DHFR
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal 58K Golgi Protein Antibody (58K-9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Canine, Chicken |
Conjugation | Unconjugated |
ALDH1L1 mouse monoclonal antibody, clone 3E9, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse |
Rabbit Polyclonal antibody to FTCD (formiminotransferase cyclodeaminase)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 251 of FTCD (Uniprot ID#O95954) |
GART mouse monoclonal antibody, clone 4D6-1D5
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
SHMT1 (374-483) mouse monoclonal antibody, clone 4F9, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Rabbit polyclonal antibody to ATIC (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 310 and 580 of ATIC (Uniprot ID#P31939) |
Rabbit polyclonal MTHFD2 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This MTHFD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 271-299 amino acids from the C-terminal region of human MTHFD2. |
Rabbit Polyclonal Anti-MTHFD1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MTHFD1 antibody: synthetic peptide directed towards the N terminal of human MTHFD1. Synthetic peptide located within the following region: RTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEKD |
Goat Polyclonal Antibody against FTCD (Internal region)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CLREQGRGKDQPGRL, from the internal region of the protein sequence according to NP_006648.1; NP_996848.1. |
Rabbit Polyclonal Anti-ATIC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATIC antibody: synthetic peptide directed towards the middle region of human ATIC. Synthetic peptide located within the following region: RTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYT |
Rabbit Polyclonal Anti-SHMT2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the N terminal of human SHMT2. Synthetic peptide located within the following region: ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQR |
Rabbit Polyclonal Anti-SHMT2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SHMT2 antibody: synthetic peptide directed towards the C terminal of human SHMT2. Synthetic peptide located within the following region: ELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDE |
Rabbit Polyclonal Anti-MTHFD1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MTHFD1 antibody: synthetic peptide directed towards the middle region of human MTHFD1. Synthetic peptide located within the following region: CMAKTHLSLSHNPEQKGVPTGFILPIRDIRASVGAGFLYPLVGTMSTMPG |
Carrier-free (BSA/glycerol-free) DHFR mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DHFR mouse monoclonal antibody, clone OTI6G7 (formerly 6G7)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI3D2 (formerly 3D2)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI4C11 (formerly 4C11)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI3B11 (formerly 3B11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI4D5 (formerly 4D5)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI5G8 (formerly 5G8)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALDH1L1 mouse monoclonal antibody, clone OTI6A10 (formerly 6A10)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MTFMT mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MTFMT mouse monoclonal antibody, clone OTI1E7 (formerly 1E7)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FTCD mouse monoclonal antibody, clone OTI1A7 (formerly 1A7)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FTCD mouse monoclonal antibody, clone OTI4F5 (formerly 4F5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FTCD mouse monoclonal antibody, clone OTI8C2 (formerly 8C2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FTCD mouse monoclonal antibody, clone OTI4A7 (formerly 4A7)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI10F12 (formerly 10F12)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI5H8 (formerly 5H8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI3F1 (formerly 3F1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI2C3 (formerly 2C3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI1A3 (formerly 1A3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) TYMS mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) AMT mouse monoclonal antibody, clone OTI6F4 (formerly 6F4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SHMT2 mouse monoclonal antibody,clone OTI1E12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SHMT2 mouse monoclonal antibody,clone OTI1E6
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SHMT2 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ATIC Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ATIC |
Anti-DHFR (Dihydrofolate reductase) mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
DHFR mouse monoclonal antibody, Clone 3A11, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
DHFR mouse monoclonal antibody, Clone 3A11, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-DHFR (Dihydrofolate reductase) mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-DHFR (Dihydrofolate reductase) mouse monoclonal antibody, clone OTI6G7 (formerly 6G7)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |