Rabbit Polyclonal Anti-OLIG2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | OLIG2 antibody was raised against a 15 amino acid peptide near the amino terminus of human OLIG2. |
Rabbit Polyclonal Anti-OLIG2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | OLIG2 antibody was raised against a 15 amino acid peptide near the amino terminus of human OLIG2. |
Rabbit Polyclonal OLIG2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody was made against a protein fragment from the N Terminus Region |
Olig2 rabbit polyclonal antibody
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
OLIG2 mouse monoclonal antibody, clone 3C9, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal anti-OLIG2 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-OLIG2 antibody: synthetic peptide directed towards the N terminal of human OLIG2. Synthetic peptide located within the following region: MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPE |
Rabbit Polyclonal Anti-OLIG2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-OLIG2 antibody: synthetic peptide directed towards the N terminal of human OLIG2. Synthetic peptide located within the following region: MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPE |
Rabbit Polyclonal Anti-OLIG2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-OLIG2 antibody is: synthetic peptide directed towards the C-terminal region of Human OLIG2. Synthetic peptide located within the following region: AAVSSASLPGSGLPSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSGASGGF |
Olig2 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-80 of human Olig2 (NP_005797.1). |
Modifications | Unmodified |