Antibodies

View as table Download

Rabbit Polyclonal Anti-G6PC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM

Rabbit Polyclonal PPARGC1A Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A.

Rabbit polyclonal IRS-1 (Ab-312) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human IRS-1 around the phosphorylation site of serine 312 (A-T-SP-P-A).

Rabbit polyclonal Akt (Ser473) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Akt
Modifications Phospho-specific

Rabbit Polyclonal Antibody against PYGM (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PYGM antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 698-727 amino acids from the C-terminal region of human PYGM.

Rabbit Polyclonal Antibody against PIK3CA (Center)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA.

Rabbit polyclonal PKC zeta (Thr410) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PKC? around the phosphorylation site of threonine 410 (T-S-TP-F-C).
Modifications Phospho-specific

Rabbit anti-MTOR polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antibody was produced against synthesized non-phosphopeptide derived fromhuman mTOR around the phosphorylation site of serine 2448 (T-D-SP-Y-S).

Anti-FOXO1 (Phospho-Ser256) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of serine 256 (A-A-S(p)-M-D) derived from Human FKHR.
Modifications Phospho-specific

AKT3 mouse monoclonal antibody, clone OTI9B2 (formerly 9B2)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

AKT3 mouse monoclonal antibody, clone OTI9B2 (formerly 9B2)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Anti-MAPK1 (ERK2) mouse monoclonal antibody, clone OTI6F8 (formerly 6F8)

Applications FC, IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Anti-MAPK1 (ERK2) mouse monoclonal antibody, clone OTI6F8 (formerly 6F8)

Applications FC, IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Anti-MAPK1 (ERK2) mouse monoclonal antibody, clone OTI4C2 (formerly 4C2)

Applications IF, IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Anti-MAPK1 (ERK2) mouse monoclonal antibody, clone OTI4C2 (formerly 4C2)

Applications IF, IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Anti-PRKAR1A (PKA regulatory subunit I alpha) mouse monoclonal antibody, clone OTI6C7 (formerly 6C7)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-PRKAR1A (PKA regulatory subunit I alpha) mouse monoclonal antibody, clone OTI6C7 (formerly 6C7)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Anti-SHC1 (SHC) mouse monoclonal antibody, clone OTI3A1 (formerly 3A1)

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-SHC1 (SHC) mouse monoclonal antibody, clone OTI3A1 (formerly 3A1)

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

SOCS3 mouse monoclonal antibody, clone OTI3D3 (formerly 3D3)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SOCS3 mouse monoclonal antibody, clone OTI3D3 (formerly 3D3)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

AKT1 mouse monoclonal antibody, clone OTI4E10 (formerly 4E10)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

AKT1 mouse monoclonal antibody, clone OTI4E10 (formerly 4E10)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

MAPK3 (ERK1) mouse monoclonal antibody, clone OTI4D7 (formerly 4D7)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

MAPK3 (ERK1) mouse monoclonal antibody, clone OTI4D7 (formerly 4D7)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

NRAS mouse monoclonal antibody, clone OTI5G7 (formerly 5G7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NRAS mouse monoclonal antibody, clone OTI5G7 (formerly 5G7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

MAP2K1 mouse monoclonal antibody,clone OTI4E1

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

MAP2K1 mouse monoclonal antibody,clone OTI4E1

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".