Antibodies

View as table Download

Rabbit Polyclonal Anti-LDHB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LDHB antibody is: synthetic peptide directed towards the C-terminal region of Human LDHB. Synthetic peptide located within the following region: MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD

Rabbit Polyclonal antibody to CBS (cystathionine-beta-synthase)

Applications IF, IHC, IP, WB
Reactivities Human
Immunogen Recombinant fragment corresponding to a region within amino acids 39 and 251 of CBS (Uniprot ID#P35520)

MTAP Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MTAP

Goat Polyclonal Antibody against MTR

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-VEKWLGPILGYDTD, from the C Terminus of the protein sequence according to NP_000245.

Rabbit Polyclonal Anti-CBS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE

Rabbit Polyclonal Anti-MAT1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAT1A antibody: synthetic peptide directed towards the N terminal of human MAT1A. Synthetic peptide located within the following region: TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE

Rabbit polyclonal anti-DNMT3B antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human DNMT3B.

DNMT3B (1-50) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human
Immunogen Synthetic peptide from Human DNMT3B (aa 1-50)

TAT (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 285~315 amino acids from the Central region of human TAT

Anti-AMD1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 20-33 amino acids of human adenosylmethionine decarboxylase 1

Anti-DNMT1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 637-650 amino acids of Human DNA (cytosine-5)-methyltransferase 1

Rabbit anti-LDHA Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human LDHA

Rabbit Polyclonal DNMT1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Contained within amino acids 1-125 of the N-terminus of human Dnmt1 [UniProt# P26358]

AMD1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a sequence at the C-terminal of human SAMDC

S adenosylhomocysteine hydrolase (AHCY) (N-term) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 86-118 amino acids from the N-terminal region of human AHCY

LDHA (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 161~190 amino acids from the Central region of Human LDHA

Rabbit Polyclonal Antibody against DNMT3a

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody was raised against amino acids 10-118 of the human DNMT3a protein.

Rabbit Polyclonal antibody to AHCYL2 (adenosylhomocysteinase-like 2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 298 and 578 of AHCYL2 (Uniprot ID#Q96HN2)

Rabbit Polyclonal Lactate Dehydrogenase A/LDHA Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide made to a C-terminal portion of the human Lactate Dehydrogenase A protein (within residues 280-332). [Swiss-Prot# P00338]

MAT1A (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 114-144 amino acids from the N-terminal region of human MAT1A

Rabbit Polyclonal antibody to MTAP (methylthioadenosine phosphorylase)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 283 of MTAP (Uniprot ID#Q13126)

Anti-DNMT3L Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human DNA (cytosine-5-)-methyltransferase 3-like

Anti-DNMT3L Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human DNA (cytosine-5-)-methyltransferase 3-like

Anti-DNMT3A Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human DNA (cytosine-5-)-methyltransferase 3 alpha

Anti-DNMT3A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human DNA (cytosine-5-)-methyltransferase 3 alpha

Anti-AMD1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 20-33 amino acids of human adenosylmethionine decarboxylase 1

Anti-DNMT1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 637-650 amino acids of Human DNA (cytosine-5)-methyltransferase 1

Anti-AMD1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 298-310 amino acids of human adenosylmethionine decarboxylase 1

Anti-AMD1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 298-310 amino acids of human adenosylmethionine decarboxylase 1

Anti-TAT Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from C terminal 250 amino acids of human tyrosine aminotransferase

Rabbit Polyclonal Anti-DNMT3A Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DNMT3A

Rabbit Polyclonal Anti-CBS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CBS

Rabbit Polyclonal Anti-TRDMT1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TRDMT1