Rabbit Polyclonal Anti-KCNK1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | KCNK1 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human KCNK1. |
Rabbit Polyclonal Anti-KCNK1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | KCNK1 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human KCNK1. |
Rabbit polyclonal anti-KCNT1 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human KCNT1. |
Rabbit Polyclonal KCNK13 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | KCNK13 antibody was raised against a 15 amino acid synthetic peptide near the center of human KCNK13. |
Rabbit polyclonal Potassium Channel Kv3.2b antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Potassium Channel Kv3.2b. |
Rabbit Polyclonal KCNK12 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | KCNK12 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of human KCNK12. |
Rabbit Polyclonal Anti-KCNQ1 Antibody
Applications | IHC, WB |
Reactivities | Hamster, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI |
Rabbit Polyclonal Anti-KCNJ15 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNJ15 |
Rabbit Polyclonal TRESK Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TRESK antibody was raised against a 17 amino acid peptide from near the center of human TRESK. |
Rabbit polyclonal Kir5.1 (Ab-416) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Kir5.1 around the phosphorylation site of serine 416 (M-E-SP-Q-M). |
KCNMA1 / BK Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Dog, Pig |
Conjugation | Unconjugated |
Immunogen | KCNMA1 / BK antibody was raised against synthetic 15 amino acid peptide from internal region of human KCNMA1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Hamster, Bovine, Dog, Rabbit, Pig, Turkey, Chicken, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%). |
KCNH2 / HERG Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Bovine, Dog, Hamster, Horse, Human, Monkey, Mouse, Pig, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | KCNH2 / HERG antibody was raised against synthetic 16 amino acid peptide from internal region of human KCNH2 / Kv11.1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse, Rabbit, Pig (100%); Bat, Guinea pig (94%). |
Rabbit anti-KCNH2 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human KCNH2 |
Rabbit Polyclonal Anti-KCNN3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rhesus macaque |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNN3 antibody: synthetic peptide directed towards the C terminal of human KCNN3. Synthetic peptide located within the following region: ITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTLRQQQQQLLSA |
Rabbit Polyclonal Anti-KCNQ2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNQ2 antibody: synthetic peptide directed towards the middle region of human KCNQ2. Synthetic peptide located within the following region: SIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAH |
Rabbit Polyclonal Anti-KCNQ2 Antibody
Applications | IHC, WB |
Reactivities | Hamster, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNQ2 antibody: synthetic peptide directed towards the N terminal of human KCNQ2. Synthetic peptide located within the following region: IDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKL |
Rabbit Polyclonal Anti-KCNQ2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNQ2 antibody: synthetic peptide directed towards the middle region of human KCNQ2. Synthetic peptide located within the following region: GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI |
Rabbit polyclonal Kv7.3/KCNQ3 (Thr246) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human: Thr246, Mouse: Thr247, Rat: Thr247 |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Kv7.3/KCNQ3 around the phosphorylation site of threonine 246 (G-G-TP-W-K). |
Modifications | Phospho-specific |
KCNMA1 / BK Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Pig, Horse |
Conjugation | Unconjugated |
Immunogen | KCNMA1 / BK antibody was raised against synthetic 15 amino acid peptide from internal region of human KCNMA1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Hamster, Bovine, Horse, Rabbit, Pig, Turkey, Chicken, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%). |
KCNJ6 / GIRK2 Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Gibbon, Bovine, Dog, Guinea pig, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Orang-Utan, Pig, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | KCNJ6 / GIRK2 antibody was raised against synthetic 18 amino acid peptide from N-terminus of human KCNJ6 / GIRK2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (100%); Panda, Bat (94%); Opossum (89%). |
KCNJ6 / GIRK2 Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Orang-Utan, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
Conjugation | Unconjugated |
Immunogen | KCNJ6 / GIRK2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human KCNJ6 / GIRK2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Pig (100%); Opossum (93%); Turkey, Platypus, Lizard (87%). |
Anti-KCNA1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 460-472 amino acids of Human potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia) |
Anti-KCNH8 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1095-1107 amino acids of Human potassium voltage-gated channel, subfamily H (eag-related), member 8 |
Anti-KCNH8 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1095-1107 amino acids of Human potassium voltage-gated channel, subfamily H (eag-related), member 8 |
Anti-KCNC2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 16-30 amino acids of Human potassium voltage-gated channel, Shaw-related subfamily, member 2 |
Anti-KCNH3 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 95-144 amino acids of Human potassium voltage-gated channel, subfamily H (eag-related), member 3 |
Anti-KCNC1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 499-511 amino acids of human potassium voltage-gated channel, Shaw-related subfamily, member 1 |
Rabbit Polyclonal Anti-KCNJ11 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human KCNJ11 |
Rabbit Polyclonal Anti-KCNK1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human KCNK1 |
Rabbit Polyclonal Anti-KCNK13 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human KCNK13 |
Rabbit Polyclonal Anti-KCNQ1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human KCNQ1 |
Rabbit Polyclonal Anti-KCNQ5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human KCNQ5 |
Rabbit Polyclonal Anti-KCNB1 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNB1 |
Rabbit Polyclonal Anti-KCNJ6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNJ6 |
Rabbit Polyclonal Anti-KCNJ9 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNJ9 |
Rabbit Polyclonal Anti-KCNA7 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNA7 |
Rabbit Polyclonal Anti-KCND1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCND1 |
Rabbit Polyclonal Anti-KCNG1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNG1 |
Rabbit Polyclonal Anti-KCNG2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNG2 |
Rabbit Polyclonal Anti-KCNG4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNG4 |
Rabbit Polyclonal Anti-KCNK9 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNK9 |
Rabbit Polyclonal Anti-KCNN4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNN4 |
Rabbit Polyclonal Anti-KCNQ4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNQ4 |
Rabbit Polyclonal Anti-KCNK3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNK3 |