Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Luteinizing Hormone beta (LHB) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, R, WB |
| Reactivities | Bovine, Deer, Goat, Human, Sheep |
| Immunogen | Bovine Luteinizing Hormone |
GnRH (GNRH1) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Mammalian |
| Conjugation | Unconjugated |
Luteinizing Hormone beta (LHB) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, R, WB |
| Reactivities | Bovine, Deer, Goat, Human, Sheep |
| Immunogen | Bovine Luteinizing Hormone |
Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human: Thr693, Mouse: Thr695, Rat: Thr694 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S). |
| Modifications | Phospho-specific |
GNAS Rabbit Polyclonal (aa385-394) Antibody
| Applications | IHC |
| Reactivities | Human, Primate |
| Conjugation | Unconjugated |
| Immunogen | GNAS antibody was raised against synthetic peptide from human GNAS. |
Rabbit polyclonal anti-EGFR antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This whole rabbit serum was prepared by repeated immunizations with a peptide synthesized using conventional technology. The sequence of the epitope maps to a region near the carboxy terminus which is identical in human, mouse and rat EGFR. |
Rabbit polyclonal EGFR-S1026 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This EGFR-S1026 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1004-1033 amino acids from the C-terminal region of human EGFR-S1026. |
Luteinizing Hormone beta (LHB) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Porcine |
| Immunogen | Porcine luteinizing hormone |
EGFR rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
EGFR rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
G protein alpha S (GNAS) (164-394) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 164 and 394 of Human GNAS |
Rabbit polyclonal EGFR phospho Y1197 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 1189-1199 of human EGFR protein. |
Rabbit polyclonal EGFR (ErbB1) Antibody (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This EGFR (ErbB1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 27-57 amino acids from the N-terminal region of human EGFR (ErbB1). |
Rabbit Polyclonal anti-GNAS antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV |
Von Willebrand Factor (VWF) rabbit polyclonal antibody, Purified
| Applications | IHC |
| Reactivities | Human |
| Immunogen | Purified Factor VIII related antigen / von Willebrand Factors. |
EGFR pTyr1092 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Rat |
EGFR pTyr1172 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
EGFR pTyr1197 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
EGFR pTyr869 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
EGFR pTyr1110 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
EGFR rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Rat |
EGFR rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
EGFR rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
EGFR rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
PLA2G3 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Immunogen | PLA2G3 antibody was raised against synthetic 16 amino acid peptide from internal region of human PLA2G3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Mouse, Rat, Dog, Hamster (94%); Elephant, Panda, Rabbit (88%); Bovine, Horse, Pig (81%). |
PLA2G3 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Gorilla, Human, Monkey, Pig |
| Conjugation | Unconjugated |
| Immunogen | PLA2G3 antibody was raised against synthetic 12 amino acid peptide from internal region of human PLA2G3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Elephant, Panda, Pig (100%); Mouse, Horse, Rabbit (92%); Bat, Dog, Opossum (83%). |
Rabbit Polyclonal Anti-EGFR Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | EGFR antibody was raised against synthetic 16 amino acid peptide from C-terminus of human EGFR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Marmoset, Rat (94%); Mouse (88%); Bovine, Dog, Hamster, Elephant, Horse (81%). |
Anti-LHB Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 114-128 amino acids of Human luteinizing hormone beta polypeptide |
Anti-GNAS Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 200 amino acids of human GNAS complex locus |
Rabbit Polyclonal FSH Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
GNRH2 Antibody
| Applications | IHC |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence SDALAPLDDSMPWEGRTTAQWSLHRKRHLARTLLTAAREPRPAPPSSNKV |
GNRH1 Antibody
| Applications | IHC |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the following sequence CSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRS |
Germany
Japan
United Kingdom
China
