Antibodies

Jump to Filters
View as table Download
UBE2N Rabbit Polyclonal Antibody
TA306183

USD 430.00

5 Days

Rabbit Polyclonal UBC13 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen UBC13 antibody was raised against a peptide corresponding to 15 amino acids near the C-terminus of human UBC13.
UBE2N Rabbit Polyclonal Antibody
TA332104

USD 310.00

5 Days

Rabbit Polyclonal Anti-UBE2N Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-UBE2N Antibody: synthetic peptide directed towards the middle region of human UBE2N. Synthetic peptide located within the following region: GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNE
UBE2N Rabbit Polyclonal Antibody
TA334746

USD 310.00

5 Days

Rabbit Polyclonal Anti-UBE2N Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-UBE2N antibody: synthetic peptide directed towards the middle region of human UBE2N. Synthetic peptide located within the following region: VDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQW