Antibodies

View as table Download

Rabbit Polyclonal Anti-SILV Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SILV antibody: synthetic peptide directed towards the N terminal of human SILV. Synthetic peptide located within the following region: HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY

Carrier-free (BSA/glycerol-free) SILV mouse monoclonal antibody, clone OTI9G3 (formerly 9G3)

Applications IF, IHC, WB
Reactivities Human, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SILV mouse monoclonal antibody, clone OTI8A4 (formerly 8A4)

Applications IF, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SILV mouse monoclonal antibody, clone OTI10E5 (formerly 10E5)

Applications IF, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SILV mouse monoclonal antibody, clone OTI7E3 (formerly 7E3)

Applications FC, IHC
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SILV mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (glycerol/BSA-free) PMEL mouse monoclonal antibody, clone OTI4D12 (formerly 4D12)

Applications IHC
Reactivities Human
Conjugation Unconjugated

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI9G3 (formerly 9G3)

Applications IF, IHC, WB
Reactivities Human, Dog
Conjugation Unconjugated

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI9G3 (formerly 9G3)

Applications IF, IHC, WB
Reactivities Human, Dog
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI8A4 (formerly 8A4)

Applications IF, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Unconjugated

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI8A4 (formerly 8A4)

Applications IF, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI10E5 (formerly 10E5)

Applications IF, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Unconjugated

Anti-SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI10E5 (formerly 10E5)

Applications IF, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI7E3 (formerly 7E3)

Applications FC, IHC
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

SILV (Melanoma gp100) mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

PMEL mouse monoclonal antibody, clone OTI4D12 (formerly 4D12)

Applications IHC
Reactivities Human
Conjugation Unconjugated