Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Insulin (INS) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Bovine, Porcine, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against PIK3CG (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3CKG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1041-1070 amino acids from the C-terminal region of human PI3CKG. |
Rabbit polyclonal PKCd (Ab-645) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PKCd around the phosphorylation site of serine 645 (R-L-SP-Y-S). |
Rabbit polyclonal IRS-1 (Ser1101) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IRS-1 around the phosphorylation site of serine 1101 (H-S-SP-E-T). |
| Modifications | Phospho-specific |
Rabbit polyclonal PKC delta Antibody (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PKC delta antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 298-326 amino acids from the N-terminal region of human PKC delta. |
Rabbit polyclonal HK2 (Hexokinase II) Antibody (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HK2 (Hexokinase II) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 91-121 amino acids from the N-terminal region of human HK2 (Hexokinase II). |
Rabbit Polyclonal Anti-HK2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-HK2 Antibody: synthetic peptide directed towards the N terminal of human HK2. Synthetic peptide located within the following region: GTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSG |
Goat Polyclonal Antibody against PIK3CA
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQWLKDKNKGEIYD, from the internal region of the protein sequence according to NP_006209.2. |
Rabbit polyclonal IRS-1 (Ser307) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | H:S307, M:S302, R:S302 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IRS-1 around the phosphorylation site of Ser307. |
| Modifications | Phospho-specific |
Phospho-PRKCZ-T410 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding T410 of human PRKCZ |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-INSR Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | INSR / Insulin Receptor antibody was raised against synthetic 16 amino acid peptide from internal region of human Insulin Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Mouse, Rat, Bovine, Dog, Elephant, Panda (94%); Bat, Horse, Pig (88%); Marmoset (81%). |
Rabbit Polyclonal Anti-CACNA1C Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CACNA1C / Cav1.2 antibody was raised against synthetic 16 amino acid peptide from internal region of human CACNA1C / Cav1.2. Percent identity with other species by BLAST analysis: Human, Gibbon (100%); Gorilla, Monkey, Marmoset (94%). |
Rabbit anti IRS-1 Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the intra domain of human IRS-1. |
Mouse anti Insulin Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human, Rat, Pig |
| Conjugation | Unconjugated |
Rabbit anti ERK2 Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from C-terminus of ERK2 protein from human, rat, mouse and dog origins. |
Carrier-free (BSA/glycerol-free) PRKCE mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ADIPOQ mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 465.00
In Stock
Active filters
Applications
- IHC
Conjugates
- Unconjugated
Pathways
- Type II diabetes mellitus
Filter by
Category
Target Symbol
- ADIPOQ (51)
- PIK3CG (34)
- MTOR (29)
- PIK3R5 (22)
- PRKCE (20)
- MAPK1 (19)
- IRS1 (18)
- PIK3CD (18)
- MAPK9 (17)
- SOCS3 (17)
- PIK3CA (14)
- TNF (13)
- MAPK8 (9)
- PDX1 (9)
- GCK (7)
- IKBKB (5)
- MAPK3 (5)
- PKM (5)
- PRKCD (5)
- HK2 (4)
- INS (4)
- PIK3R1 (4)
- CACNA1C (3)
- IRS2 (3)
- SLC2A2 (3)
- SLC2A4 (3)
- SOCS1 (3)
- ABCC8 (2)
- HK1 (2)
- PIK3R3 (2)
- PKLR (2)
- PRKCZ (2)
- CACNA1A (1)
- CACNA1D (1)
- CACNA1E (1)
- CACNA1G (1)
- HK3 (1)
- INSR (1)
- IRS4 (1)
- KCNJ11 (1)
- MAPK10 (1)
- PIK3CB (1)
- PIK3R2 (1)
- SOCS2 (1)
- SOCS4 (1)
Reactivities
Antibody Hosts
Isotypes
Clonalities
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (358)
- Protein Kinase (113)
- ES Cell Differentiation/IPS (81)
- Secreted Protein (68)
- Transmembrane (30)
- Transcription Factors (27)
- Embryonic stem cells (9)
- Induced pluripotent stem cells (9)
- Ion Channels: Calcium (7)
- Stem cell - Pluripotency (3)
- Stem cell relevant signaling - JAK/STAT signaling pathway (3)
- Ion Channels: Potassium (1)