Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-Protease-activated Receptor-4 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)HLRGQRWPFGEAA(S)R, corresponding to amino acid residues 136-150 of human PAR-4. Cys 149 was replaced with Ser. 1st extracellular loop. |
Rabbit Polyclonal Anti-alpha1B-Adrenoceptor (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)KNANFTGPNQTSSNS, corresponding to amino acid residues 21-35 of human a1B-adrenoceptor . Extracellular, N-terminus. |
Rabbit anti-LEP Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LEP |
Rabbit Polyclonal Anti-LHCGR Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | LHCGR / LHR / LH Receptor antibody was raised against synthetic 19 amino acid peptide from C-terminus of human hCG receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset, Rat, Dog, Panda (95%); Bovine, Bat, Rabbit, Horse (89%); Ferret (84%). |
5HT5A receptor (HTR5A) rabbit polyclonal antibody
| Applications | IF, IHC, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
HTR2C rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Goat Polyclonal Antibody against Leptin Receptor
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TQDDIEKHQSDAG, from the internal region of the protein sequence according to NP_002294.2; NP_001003679.1; NP_001003680.1. |
Rabbit polyclonal antibody to alpha 2 Glycine Receptor (glycine receptor, alpha 2)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 216 of Glycine Receptor alpha 2 (Uniprot ID#P23416) |
Rabbit Polyclonal antibody to Glucocorticoid Receptor beta (nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor))
| Applications | IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 265 of Glucocorticoid Receptor beta (Uniprot ID#P04150) |
Rabbit polyclonal Glutamate receptor 2 (Ab-880) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Glutamate receptor 2 around the phosphorylation site of serine 880 (I-E-S-V-K). |
Rabbit polyclonal Glutamate receptor 2 (Ser880) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Glutamate receptor 2 around the phosphorylation site of serine 880 (I-E-SP-V-K). |
| Modifications | Phospho-specific |
DRD5 / Dopamine Receptor D5 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | DRD5 / Dopamine Receptor D5 antibody was raised against synthetic 16 amino acid peptide from 3rd extracellular domain of human DRD5 / Dopamine Receptor D5. Percent identity with other species by BLAST analysis: Human (100%); Gorilla (94%); Gibbon, Monkey (88%); Marmoset (81%). |
Anti-CHRM2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 208-388 amino acids of human cholinergic receptor, muscarinic 2 |
Rabbit polyclonal NR3C1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NR3C1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 713-742 amino acids from the C-terminal region of human NR3C1. |
Rabbit polyclonal NR3C1 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This NR3C1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-262 amino acids from the Central region of human NR3C1. |
Rabbit polyclonal PLG Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PLG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 636-665 amino acids from the C-terminal region of human PLG. |
USD 450.00
5 Days
Rabbit polyclonal GIPR Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GIPR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 7-38 amino acids from the N-terminal region of human GIPR. |
Rabbit polyclonal GABRA2 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GABRA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 378-406 amino acids from the C-terminal region of human GABRA2. |
Rabbit Polyclonal Anti-Bombesin Receptor 3 (extracellular)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)SNVYTFRDPNKNMTFE, corresponding to amino acid residues 186-201 of human BB3. 2nd extracellular loop. |
Rabbit Polyclonal Anti-GABA (A) alpha3 Receptor (extracellular)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide QGESRRQEPGDFVKQ(C), corresponding to amino acid residues 29-43 of human GABA (A) a3 Receptor. Extracellular, N-terminus. |
Rabbit Polyclonal Anti-GABRP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRP antibody: synthetic peptide directed towards the N terminal of human GABRP. Synthetic peptide located within the following region: VEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEPVQIALTLDIASISSISE |
Rabbit Polyclonal Anti-TAAR6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rhesus macaque |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAAR6 antibody is: synthetic peptide directed towards the C-terminal region of Human TAAR6. Synthetic peptide located within the following region: YGNIFLVARRQAKKIENTGSKTESSSESYKARVARRERKAAKTLGVTVVA |
Rabbit Polyclonal Anti-P2RX1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P2RX1 antibody: synthetic peptide directed towards the middle region of human P2RX1. Synthetic peptide located within the following region: VVGITIDWHCDLDWHVRHCRPIYEFHGLYEEKNLSPGFNFRFARHFVENG |
Rabbit Polyclonal Anti-MAS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAS1 antibody: synthetic peptide directed towards the middle region of human MAS1. Synthetic peptide located within the following region: VIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHSSKLYIVIMVTIII |
Rabbit Polyclonal Anti-GPR35 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GPR35 antibody was raised against synthetic 18 amino acid peptide from 3rd extracellular domain of human GPR35. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (83%). |
Rabbit Polyclonal Anti-PTGDR Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | PTGDR / DP antibody was raised against synthetic 20 amino acid peptide from 3rd extracellular domain of human Prostaglandin D2 Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset (95%); Dog, Pig (85%); Panda, Bovine (80%). |
Rabbit Polyclonal Anti-HTR1F Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | HTR1F / 5-HT1F Receptor antibody was raised against synthetic 19 amino acid peptide from N-terminal extracellular domain of human 5HT1F Receptor. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Rat, Bovine, Rabbit (100%); Mouse, Elephant, Panda, Bat, Guinea pig (95%); Platypus (84%). |
Rabbit Polyclonal Anti-NMBR Antibody (Cytoplasmic Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | NMBR antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human NMBR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Panda, Bovine, Bat, Horse, Rabbit, Pig (100%); Marmoset, Rat, Hamster, Dog, Opossum (94%); Platypus (88%); Elephant, Xenopus (81%). |
Rabbit Polyclonal Anti-TACR1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | TACR1 / NK1R antibody was raised against synthetic 18 amino acid peptide from C-terminus of human Neurokinin 1 Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Rat, Hamster, Panda, Horse, Rabbit, Guinea pig (100%); Mouse, Dog, Elephant (94%); Marmoset, Bat, Bovine (89%). |
5HT5A receptor (HTR5A) (17-34) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Applications
- IHC
Conjugates
- Unconjugated
Pathways
- Neuroactive ligand-receptor interaction
Filter by
Category
Target Symbol
- NR3C1 (31)
- CSH1 (10)
- GABRA5 (10)
- PRL (9)
- THRA (8)
- GRIA2 (7)
- GRM4 (7)
- GRM1 (6)
- LEP (6)
- ADRA1B (5)
- F2R (5)
- GRIK1 (5)
- GRPR (5)
- HTR1F (5)
- HTR2B (5)
- KISS1R (5)
- NPY1R (5)
- PLG (5)
- S1PR1 (5)
- ADORA2A (4)
- ADRA1A (4)
- ADRB3 (4)
- APLNR (4)
- CCKAR (4)
- CHRM1 (4)
- CNR2 (4)
- GH2 (4)
- GRIN1 (4)
- HCRTR1 (4)
- HTR2C (4)
- MAS1 (4)
- MC4R (4)
- P2RX2 (4)
- S1PR3 (4)
- S1PR5 (4)
- SSTR1 (4)
- ADORA2B (3)
- ADORA3 (3)
- ADRB2 (3)
- AGTR2 (3)
- BDKRB2 (3)
- CALCRL (3)
- DRD4 (3)
- DRD5 (3)
- FPR2 (3)
- FSHR (3)
- GABBR1 (3)
- GABRA3 (3)
- GIPR (3)
- GRIA3 (3)
- GRM3 (3)
- GRM7 (3)
- GRM8 (3)
- HRH3 (3)
- HTR5A (3)
- HTR7 (3)
- LPAR4 (3)
- MC1R (3)
- NMBR (3)
- NTSR1 (3)
- OPRM1 (3)
- P2RX1 (3)
- P2RY1 (3)
- P2RY2 (3)
- PTGER3 (3)
- SSTR2 (3)
- SSTR5 (3)
- TSHR (3)
- ADCYAP1R1 (2)
- AGTR1 (2)
- BDKRB1 (2)
- BRS3 (2)
- C3AR1 (2)
- CALCR (2)
- CHRM2 (2)
- CHRM5 (2)
- CYSLTR1 (2)
- DRD1 (2)
- DRD2 (2)
- DRD3 (2)
- EDNRB (2)
- F2 (2)
- F2RL2 (2)
- GABRA2 (2)
- GALR2 (2)
- GH1 (2)
- GLP1R (2)
- GLP2R (2)
- GLRA1 (2)
- GNRHR (2)
- GPR50 (2)
- GRIK4 (2)
- GRIK5 (2)
- GRIN2A (2)
- GRIN2B (2)
- GRIN2C (2)
- GRIN2D (2)
- GRM2 (2)
- GRM5 (2)
- HRH1 (2)
Reactivities
- Human (503)
- Mouse (314)
- Rat (311)
- Monkey (76)
- Dog (40)
- Gorilla (39)
- Bovine (35)
- Rabbit (33)
- Bat (30)
- Horse (29)
- Gibbon (27)
- Pig (24)
- Hamster (23)
- Chimpanzee (10)
- Guinea Pig (10)
- Chicken (6)
- Xenopus (6)
- Orang-Utan (5)
- Primate (5)
- Rhesus Monkey (5)
- Canine (2)
- Cow (2)
- Sheep (2)
- Goat (1)
- Macaque (1)
- Zebrafish (1)
Antibody Hosts
Isotypes
Clonalities
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (511)
- Transmembrane (424)
- GPCR (322)
- Transcription Factors (43)
- Nuclear Hormone Receptor (40)
- Secreted Protein (39)
- Ion Channels: Glutamate Receptors (33)
- Ion Channels: Cys-loop Receptors (25)
- ES Cell Differentiation/IPS (10)
- Ion Channels: ATP Receptors (9)
- Protease (7)
- Ion Channels: Sodium (2)
- Ion Channels: Transient receptor potential (2)