Rabbit Monoclonal antibody against CPS1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Monoclonal antibody against CPS1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CPS1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CPS1 antibody: synthetic peptide directed towards the N terminal of human CPS1. Synthetic peptide located within the following region: QWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQPVDFVDPNKQNL |
Rabbit Polyclonal Anti-CPS1 Antibody
Applications | IHC, WB |
Reactivities | Human, Pig |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CPS1 antibody: synthetic peptide directed towards the middle region of human CPS1. Synthetic peptide located within the following region: YPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSI |
Carrier-free (BSA/glycerol-free) CPS1 mouse monoclonal antibody, clone OTI7B6
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CPS1 mouse monoclonal antibody, clone OTI7B6
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CPS1 mouse monoclonal antibody, clone OTI7B6
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CPS1 mouse monoclonal antibody, clone UMAB281
Applications | IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CPS1 mouse monoclonal antibody, clone UMAB281
Applications | IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
CPS1 mouse monoclonal antibody, clone UMAB282
Applications | IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CPS1 mouse monoclonal antibody, clone UMAB282
Applications | IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
CPS1 mouse monoclonal antibody, clone UMAB281
Applications | IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CPS1 mouse monoclonal antibody, clone UMAB282
Applications | IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".