Antibodies

Jump to Filters
View as table Download
BHMT Rabbit Polyclonal Antibody
TA346077

USD 410.00

5 Days

Rabbit Polyclonal Anti-BHMT Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-BHMT antibody: synthetic peptide directed towards the N terminal of human BHMT. Synthetic peptide located within the following region: AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE
BHMT Rabbit Polyclonal Antibody
TA346078

USD 410.00

5 Days

Rabbit Polyclonal Anti-BHMT Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-BHMT antibody: synthetic peptide directed towards the C terminal of human BHMT. Synthetic peptide located within the following region: KHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVT
BHMT Rabbit Polyclonal Antibody
TA308186

USD 415.00

5 Days

Rabbit Polyclonal antibody to BHMT (betaine-homocysteine methyltransferase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 199 and 406 of BHMT (Uniprot ID#Q93088)
BHMT Rabbit Polyclonal Antibody
TA308187

USD 415.00

5 Days

Rabbit Polyclonal antibody to BHMT (betaine-homocysteine methyltransferase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 243 of BHMT (Uniprot ID#Q93088)
BHMT Mouse Monoclonal Antibody [Clone ID: OTI3E11]
CF500959

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) BHMT mouse monoclonal antibody, clone OTI3E11 (formerly 3E11)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
BHMT Mouse Monoclonal Antibody [Clone ID: OTI1E5]
CF500961

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) BHMT mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
BHMT Mouse Monoclonal Antibody [Clone ID: OTI2F6]
CF501049

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) BHMT mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
BHMT Mouse Monoclonal Antibody [Clone ID: OTI3E11]
TA500959

USD 379.00

In Stock

Anti-BHMT mouse monoclonal antibody, clone OTI3E11 (formerly 3E11)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
BHMT Mouse Monoclonal Antibody [Clone ID: OTI3E11]
TA500959S

USD 159.00

2 Days

Anti-BHMT mouse monoclonal antibody, clone OTI3E11 (formerly 3E11)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

BHMT Mouse Monoclonal Antibody [Clone ID: OTI1E5]
TA500961

USD 379.00

In Stock

Anti-BHMT mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
BHMT Mouse Monoclonal Antibody [Clone ID: OTI1E5]
TA500961S

USD 159.00

2 Days

Anti-BHMT mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

BHMT Mouse Monoclonal Antibody [Clone ID: OTI2F6]
TA501049

USD 379.00

In Stock

BHMT mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
BHMT Mouse Monoclonal Antibody [Clone ID: OTI2F6]
TA501049S

USD 159.00

2 Days

BHMT mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".