Antibodies

Jump to Filters
View as table Download
Annexin A1 (ANXA1) Rabbit Polyclonal Antibody
TA326936

USD 374.00

3 Weeks

ANXA1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ANXA1
Annexin A1 (ANXA1) (324-337) Goat Polyclonal Antibody
AP22515PU-N

USD 440.00

2 Weeks

Annexin A1 (ANXA1) (324-337) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bat, Bovine, Canine, Equine, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat
Immunogen Peptide from the C Terminus of the protein sequence according to NP_000691.1
Annexin A1 (ANXA1) Rabbit Polyclonal Antibody
TA308701

USD 415.00

2 Weeks

Rabbit polyclonal antibody to Annexin A1 (annexin A1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 228 of Annexin A1 (Uniprot ID#P04083)
Annexin A1 (ANXA1) Mouse Monoclonal Antibody [Clone ID: 2F1]
TA336944

USD 374.00

5 Days

Mouse Monoclonal Annexin A1 Antibody (2F1)

Applications IHC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated
Annexin A1 (ANXA1) Rabbit Polyclonal Antibody
TA341644

USD 310.00

5 Days

Rabbit Polyclonal Anti-ANXA1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ANXA1 antibody: synthetic peptide directed towards the N terminal of human ANXA1. Synthetic peptide located within the following region: WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVD
Annexin A1 (ANXA1) (N-term) Rabbit Polyclonal Antibody
AP22730PU-N

USD 440.00

2 Weeks

Annexin A1 (ANXA1) (N-term) rabbit polyclonal antibody, Purified

Applications IHC
Reactivities Human
Immunogen ANXA1 antibody was raised against synthetic peptide corresponding to N-terminal of human annexin I
Annexin A1 (ANXA1) Mouse Monoclonal Antibody [Clone ID: OTI3A8]
CF500967

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ANXA1 mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Annexin A1 (ANXA1) Mouse Monoclonal Antibody [Clone ID: OTI3A8]
TA500967

USD 379.00

In Stock

Anti-ANXA1 (Annexin A1) mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Annexin A1 (ANXA1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A8]
TA500967AM

USD 420.00

4 Weeks

Anti-ANXA1 (Annexin A1) mouse monoclonal antibody, clone OTI3A8 (formerly 3A8), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Annexin A1 (ANXA1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A8]
TA500967BM

USD 420.00

4 Weeks

Anti-ANXA1 (Annexin A1) mouse monoclonal antibody, clone OTI3A8 (formerly 3A8), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Annexin A1 (ANXA1) Mouse Monoclonal Antibody [Clone ID: OTI3A8]
TA500967S

USD 159.00

In Stock

Anti-ANXA1 (Annexin A1) mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated