Rabbit Monoclonal Antibody against NOTCH1 (Clone EP1238Y)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Cow |
Conjugation | Unconjugated |
Rabbit Monoclonal Antibody against NOTCH1 (Clone EP1238Y)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Cow |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-HES5 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | HES5 antibody was raised against a 19 amino acid peptide near the amino terminus of human HES5. |
Rabbit Polyclonal Anti-JAG1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | JAG1 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human JAG1. |
Rabbit Polyclonal Anti-Beclin 2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Beclin 2 antibody was raised against a 16 amino acid peptide near the amino terminus of human Beclin 2. |
Rabbit Polyclonal DLL3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Primate |
Conjugation | Unconjugated |
Immunogen | A portion of amino acid 100 to 150 of human DLL3 was used as immunogen for the antibody. |
Rabbit polyclonal Notch 1 (Cleaved-Val1744) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Notch 1. |
Rabbit polyclonal anti-Jagged 1 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This protein A purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 110-125 of human Jagged-1protein. |
Rabbit Polyclonal APH1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | APH1 antibody was raised against a 18 amino acid peptide from near the center of human APH1. |
Rabbit polyclonal anti-DELTA-4 antibody
Applications | IHC, WB |
Reactivities | Human, partial reactivity to Mouse and Rat |
Conjugation | Unconjugated |
Immunogen | Anti-DELTA-4 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of Human DELTA-4. |
Rabbit polyclonal DVL1 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This DVL1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 442-470 amino acids from the Central region of human DVL1. |
Rabbit polyclonal DVL3 Antibody (C-term)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This DVL3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 530-557 amino acids from the C-terminal region of human DVL3. |
Rabbit Polyclonal Notch-1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of the human NOTCH1 protein (between residues 2300-2350) [UniProt P46531] |
Rabbit Polyclonal HES5 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A portion of amino acid1-50 of human HES5 was used as the immunogen for this antibody. |
Goat Polyclonal Antibody against APH1A
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HVTDRSDARLQYG, from the internal region of the protein sequence according to NP_001071096.1; NP_057106.2. |
Goat Anti-JAG1 Antibody
Applications | IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TNKQDNRDLESAQS, from the C Terminus of the protein sequence according to NP_000205.1. |
Rabbit Polyclonal Anti-DVL2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DVL2 antibody: synthetic peptide directed towards the N terminal of human DVL2. Synthetic peptide located within the following region: AGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPA |
Rabbit polyclonal anti-Notch 1 antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Anti-Notch antibody was prepared by repeated immunizations with a synthetic peptide corresponding to amino acid residues 2488-2502 of human Notch 1. A residue of cysteine was added to the amino terminal end to facilitate coupling. |
Rabbit Polyclonal HES-1 Antibody
Applications | IHC |
Reactivities | Bovine, Human, Mouse, Primate, Rat |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 230-280 of human HES1 was used as the immunogen. |
Rabbit anti Notch 1 Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide derived from C-terminus of human Notch 1. |
Carrier-free (BSA/glycerol-free) Notch1 mouse monoclonal antibody, clone OTI3E12 (formerly 3E12)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HES1 mouse monoclonal antibody, clone OTI4H1 (formerly 4H1)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) Notch1 mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HES1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HES1 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HES1 mouse monoclonal antibody, clone OTI7B9 (formerly 7B9)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HES1 mouse monoclonal antibody, clone OTI1B5 (formerly 1B5)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DVL2 mouse monoclonal antibody, clone OTI7C7 (formerly 7C7)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DVL2 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) DVL2 mouse monoclonal antibody, clone OTI2E11 (formerly 2E11)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) JAG1 mouse monoclonal antibody, clone OTI3A10 (formerly 3A10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NOTCH1 mouse monoclonal antibody, clone OTI2E7 (formerly 2E7)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-NOTCH1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 2541-2555 amino acids of Human notch 1 |
Anti-NOTCH1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 2541-2555 amino acids of human notch 1 |
Rabbit Polyclonal Anti-DLL4 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DLL4 |
Rabbit Polyclonal Anti-DVL2 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DVL2 |
Rabbit Polyclonal Anti-JAG1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human JAG1 |
Anti-Notch1 mouse monoclonal antibody, clone OTI3E12 (formerly 3E12)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
Notch1 mouse monoclonal antibody,clone 3E12, Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Notch1 mouse monoclonal antibody,clone 3E12, HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-Notch1 mouse monoclonal antibody, clone OTI3E12 (formerly 3E12)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-HES1 mouse monoclonal antibody, clone OTI4H1 (formerly 4H1)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-HES1 mouse monoclonal antibody, clone OTI4H1 (formerly 4H1)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-Notch1 mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-Notch1 mouse monoclonal antibody, clone OTI4C9 (formerly 4C9), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Anti-Notch1 mouse monoclonal antibody, clone OTI4C9 (formerly 4C9), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Anti-Notch1 mouse monoclonal antibody, clone OTI4C9 (formerly 4C9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
HES1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HES1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
HES1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
HES1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".