Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus. |
GRPR Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Dog, Gorilla, Horse, Human, Monkey, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | GRPR antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Horse, Rabbit, Pig (100%); Bovine (94%); Mouse, Rat, Hamster (83%). |
B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%). |
Rabbit Polyclonal Anti-ADORA2B Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ADORA2B antibody was raised against a 19 amino acid peptide near the carboxy terminus of human ADORA2B. The immunogen is located within the last 50 amino acids of ADORA2B. |
Rabbit Polyclonal Anti-CYSLTR1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CYSLTR1 / CYSLT1 antibody was raised against synthetic 20 amino acid peptide from C-terminus of human CYSLTR1 / CYSLT1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey, Marmoset (95%); Gibbon, Mouse, Panda (90%); Rat, Bovine, Elephant, Rabbit, Pig (85%). |
5HT7 Receptor (HTR7) (8-23) rabbit polyclonal antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Dopamine Receptor D1 / DRD1 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | DRD1 / Dopamine Receptor D1 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human DRD1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon, Marmoset (95%); Elephant (90%); Dog, Rabbit (85%); Horse (80%). |
Rabbit Polyclonal Anti-M1 Muscarinic Receptor (443-458)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)RKIPKRPGSVHRTPSR, corresponding to amino acid residues 443-458 of human M1 Muscarinic Receptor. Intracellular, C-terminus. |
Rabbit Polyclonal Anti-CYSLTR1 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CYSLTR1 / CYSLT1 antibody was raised against synthetic 20 amino acid peptide from 3rd extracellular domain of human CYSLTR1 / CYSLT1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Rabbit, Guinea pig (85%); Bovine, Elephant, Horse, Pig (80%). |
ADRB3 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ADRB3 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human ADRB3. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Monkey (94%). |
Rabbit anti-CHRM1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CHRM1 |
Rabbit Polyclonal antibody to Histamine H2 Receptor (histamine receptor H2)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 45 of Histamine H2 Receptor (Uniprot ID#P25021) |
Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348) |
USD 425.00
In Stock
CHRM3 / M3 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | CHRM3 / M3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human CHRM3 / M3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Chimpanzee, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (95%); Opossum, Turkey, Chicken, Lizard (89%). |
B1R / BDKRB1 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human, Monkey, Gorilla |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (94%); Rat, Hamster (89%); Mouse, Rabbit, Horse (83%). |
HRH1 / H1 Receptor Goat Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Chimpanzee, Gorilla, Human, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | HRH1 / Histamine H1 Receptor antibody was raised against synthetic peptide CNENFKKTFKRILH from the C-terminus of human HRH1 / Histamine H1 Receptor (NP_000852.1; NP_001091681.1; NP_001091682.1; NP_001091683.1). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Bat, Platypus (100%); Monkey, Mouse, Rat, Dog, Bovine, Hamster, Elephant, Panda, Rabbit, Horse, Pig, Turkey, Chicken (93%); Marmoset, Guinea pig, Xenopus (86%). |
Rabbit Polyclonal Anti-Neurotensin Receptor 1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide EQNRSADGQHAGGLVC corresponding to amino acid residues 209-224 of human Neurotensin Receptor 1. 2nd extracellular loop. |
USD 531.00
In Stock
Rabbit Polyclonal Anti-Human Protease-activated Receptor-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)KNESGLTEYRLVSINK, corresponding to amino acid residues 61-76 of human PAR-1. Extracellular, N terminal. |
Rabbit Polyclonal Anti-alpha1B-Adrenoceptor (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)KNANFTGPNQTSSNS, corresponding to amino acid residues 21-35 of human a1B-adrenoceptor . Extracellular, N-terminus. |
HTR2C rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
DRD5 / Dopamine Receptor D5 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | DRD5 / Dopamine Receptor D5 antibody was raised against synthetic 16 amino acid peptide from 3rd extracellular domain of human DRD5 / Dopamine Receptor D5. Percent identity with other species by BLAST analysis: Human (100%); Gorilla (94%); Gibbon, Monkey (88%); Marmoset (81%). |
Anti-CHRM2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 208-388 amino acids of human cholinergic receptor, muscarinic 2 |
Rabbit Polyclonal Anti-TACR1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | TACR1 / NK1R antibody was raised against synthetic 18 amino acid peptide from C-terminus of human Neurokinin 1 Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Rat, Hamster, Panda, Horse, Rabbit, Guinea pig (100%); Mouse, Dog, Elephant (94%); Marmoset, Bat, Bovine (89%). |
HTR2C rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
GRPR Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Hamster, Human, Monkey, Mouse, Pig, Rat |
| Conjugation | Unconjugated |
| Immunogen | GRPR antibody was raised against synthetic 17 amino acid peptide from 3rd cytoplasmic domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Bovine, Dog, Bat, Pig (100%); Panda, Rabbit, Opossum (94%); Horse (88%); Turkey, Chicken, Lizard (82%). |
HTR6 / 5-HT6 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Chimpanzee, Dog, Gorilla, Hamster, Horse, Human, Monkey, Rat |
| Conjugation | Unconjugated |
| Immunogen | HTR6 / 5-HT6 Receptor antibody was raised against synthetic 17 amino acid peptide from C-terminus of human HTR6 / 5-HT36. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Marmoset, Rat, Hamster, Panda, Dog, Horse (100%); Mouse, Elephant, Bovine, Bat, Rabbit (94%); Stickleback, Pufferfish (88%); Turkey, Chicken, Xenopus, Zebrafish (82%). |
Alpha 1b / ADRA1B Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rat |
| Conjugation | Unconjugated |
| Immunogen | ADRA1B antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human ADRA1B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Hamster, Elephant, Panda, Horse, Pig, Opossum (100%); Bat (94%); Turkey, Chicken (88%); Platypus (81%). |
Rabbit Polyclonal Anti-M1 Muscarinic Receptor
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GST fusion protein with a sequence GSETPGKGGGSSSSSERSQP GAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSS EGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDR AGKGQKPRGKEQLAKRK, corresponding to amino acid residues 227-353 of human m1.3rd intracellular loop. |
Rabbit Polyclonal Anti-M2 Muscarinic Receptor
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GST fusion protein with a sequence VANQDPVSPSLVQGRIVKPN NNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSV SAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKS DSCTPTNTTVEVVGSSGQNGDE, corresponding to amino acid.� residues 225-356 of human m2. 3rd intracellular loo |
Rabbit Polyclonal Anti-alpha1A-Adrenoceptor (extracellular)
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide EDETI*SQINEEPG(C), corresponding to amino acid residues 171-183 of human a1A adrenoceptor with replacement of cysteine 176 (C176) with serine. 2nd extracellular loop. |
Germany
Japan
United Kingdom
China
