Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 27 of 27 results

(reset)

BDNF Rabbit Polyclonal Antibody

TA328615

USD 585.00

2 Weeks

Rabbit Polyclonal Anti-BDNF

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Peptide (C)VLEKVPVSKQLK, corresponding to amino acid residues 166-178 of human BDNF (precursor).

1 / 2

2 / 2

Previous Next

BDNF Rabbit Polyclonal Antibody

TA346304

USD 475.00

5 Days

Rabbit Polyclonal Anti-BDNF Antibody

Applications	IHC, WB
Reactivities	Human, Macaque, Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

BDNF Goat Polyclonal Antibody

TA348982

USD 429.00

5 Days

Goat Polyclonal Anti-BDNF Antibody

Applications	IF, IHC
Reactivities	Human, Mouse, Rat (Expected from sequence similarity: Dog)
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1.

1 / 3

2 / 3

3 / 3

Previous Next

BDNF Rabbit Polyclonal Antibody

TA327032

USD 275.00

3 Weeks

Rabbit anti-BDNF Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human BDNF

1 / 3

2 / 3

3 / 3

Previous Next

BDNF Rabbit Polyclonal Antibody

TA328614

USD 585.00

2 Weeks

Rabbit Polyclonal Anti-proBDNF

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Peptide (C)DEDQKVRPNEENNKDAD, corresponding to amino acid residues 72-88 of human BDNF (precursor). Pro-domain of the BDNF protein.

1 / 3

2 / 3

3 / 3

Previous Next

c-Myc (MYC) Rabbit Polyclonal Antibody

TA326222

USD 345.00

In Stock

Rabbit polyclonal MYC antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from C-terminal of human Myc.

1 / 2

2 / 2

Previous Next

c-Myc (MYC) Rabbit Polyclonal Antibody

TA336686

USD 424.00

5 Days

Rabbit Polyclonal c-Myc Antibody

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	A synthetic peptide made to the human c-Myc protein (between residues 400-450) [UniProt P01106]

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

c-Myc (MYC) Rabbit Polyclonal Antibody

TA325703

USD 345.00

4 Weeks

Rabbit Polyclonal C-myc antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthesized peptide derived from human C-myc

1 / 2

2 / 2

Previous Next

c-Myc (MYC) Rabbit Polyclonal Antibody

TA302042

USD 450.00

5 Days

Rabbit Polyclonal Antibody against MYC (T58)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This MYC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 36-65 amino acids from human MYC.

1 / 2

2 / 2

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI1A6]

CF500002

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) c-Myc mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 19

2 / 19

3 / 19

4 / 19

5 / 19

6 / 19

7 / 19

8 / 19

9 / 19

10 / 19

11 / 19

12 / 19

13 / 19

14 / 19

15 / 19

16 / 19

17 / 19

18 / 19

19 / 19

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI3F2]

CF500003

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) c-Myc mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI5G3]

CF500004

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) c-Myc mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

FGF4 Rabbit Polyclonal Antibody

TA323076

USD 345.00

In Stock

Anti-FGF4 Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 192-206 amino acids of Human fibroblast growth factor 4

BDNF Rabbit Polyclonal Antibody

TA323908

USD 345.00

In Stock

Anti-BDNF Rabbit Polyclonal Antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 19-247 amino acids of human brain-derived neurotrophic factor

BDNF Rabbit Polyclonal Antibody

TA323909

USD 345.00

In Stock

Anti-BDNF Rabbit Polyclonal Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 153-168 amino acids of Human brain-derived neurotrophic factor

EGF Rabbit Polyclonal Antibody

TA324063

USD 345.00

In Stock

Anti-EGF Rabbit Polyclonal Antibody

Applications	ELISA, IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 926-1026 amino acids of human epidermal growth factor

EGF Rabbit Polyclonal Antibody

TA324064

USD 345.00

In Stock

Anti-EGF Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 926-1026 amino acids of human epidermal growth factor

1 / 3

2 / 3

3 / 3

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI1A6]

TA500002

USD 379.00

In Stock

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 19

2 / 19

3 / 19

4 / 19

5 / 19

6 / 19

7 / 19

8 / 19

9 / 19

10 / 19

11 / 19

12 / 19

13 / 19

14 / 19

15 / 19

16 / 19

17 / 19

18 / 19

19 / 19

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI1A6]

TA500002S

USD 159.00

2 Days

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 19

2 / 19

3 / 19

4 / 19

5 / 19

6 / 19

7 / 19

8 / 19

9 / 19

10 / 19

11 / 19

12 / 19

13 / 19

14 / 19

15 / 19

16 / 19

17 / 19

18 / 19

19 / 19

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI3F2]

TA500003

USD 379.00

In Stock

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F2]

TA500003AM

USD 420.00

4 Weeks

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI3F2 (formerly 3F2), Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3F2]

TA500003BM

USD 420.00

4 Weeks

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI3F2 (formerly 3F2), HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI3F2]

TA500003S

USD 159.00

In Stock

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI5G3]

TA500004

USD 379.00

In Stock

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5G3]

TA500004AM

USD 420.00

4 Weeks

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI5G3 (formerly 5G3), Biotinylated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G3]

TA500004BM

USD 420.00

4 Weeks

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI5G3 (formerly 5G3), HRP conjugated

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

c-Myc (MYC) Mouse Monoclonal Antibody [Clone ID: OTI5G3]

TA500004S

USD 159.00

2 Days

c-Myc (c-Myc ) mouse monoclonal antibody, clone OTI5G3 (formerly 5G3)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Special Offer: Get this product for $99/€99. Use code: "Truesample".

1 - 27 of 27 results