Rabbit Polyclonal Anti-KV11.1 (HERG) (extracellular)
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide AFLLKETEEGPPATEC corresponding to residues 430-445 of human KV11.1 (HERG). Extracellular, between S1 and S2 domains. |
Rabbit polyclonal anti-KCNT1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human KCNT1. |
Mouse Monoclonal anti-slo1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-KCNQ1 Antibody
| Applications | IHC, WB |
| Reactivities | Hamster, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ1 antibody: synthetic peptide directed towards the N terminal of human KCNQ1. Synthetic peptide located within the following region: RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI |
Rabbit Polyclonal Anti-KCNA10 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNA10 antibody: synthetic peptide directed towards the middle region of human KCNA10. Synthetic peptide located within the following region: PANVPIDIFADEISFYELGSEAMDQFREDEGFIKDPETLLPTNDIHRQFW |
Rabbit Polyclonal Anti-KCNK13 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Dog |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNK13 antibody: synthetic peptide directed towards the C terminal of human KCNK13. Synthetic peptide located within the following region: GEMISMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGA |
Rabbit polyclonal Kir5.1 (Ab-416) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Kir5.1 around the phosphorylation site of serine 416 (M-E-SP-Q-M). |
Rabbit Polyclonal Anti-KCNMA1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNMA1 antibody: synthetic peptide directed towards the c terminal region of human KCNMA1. Synthetic peptide located within the following region: CFGIYRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAG |
Rabbit Polyclonal Anti-KCNN2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat, Rhesus macaque |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNN2 antibody: synthetic peptide directed towards the C terminal of human KCNN2. Synthetic peptide located within the following region: IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM |
Rabbit Polyclonal Anti-KCNH5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNH5 antibody: synthetic peptide directed towards the N terminal of human KCNH5. Synthetic peptide located within the following region: LTNSRSVLQQLTPMNKTEVVHKHSRLAEVLQLGSDILPQYKQEAPKTPPH |
Rabbit polyclonal antibody to GIRK1 (potassium inwardly-rectifying channel, subfamily J, member 3)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 248 and 501 of GIRK1 (Uniprot ID#P48549) |
KCNMA1 / BK Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Dog, Pig |
| Conjugation | Unconjugated |
| Immunogen | KCNMA1 / BK antibody was raised against synthetic 15 amino acid peptide from internal region of human KCNMA1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Hamster, Bovine, Dog, Rabbit, Pig, Turkey, Chicken, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%). |
KCNH2 / HERG Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Hamster, Horse, Human, Monkey, Mouse, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | KCNH2 / HERG antibody was raised against synthetic 16 amino acid peptide from internal region of human KCNH2 / Kv11.1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse, Rabbit, Pig (100%); Bat, Guinea pig (94%). |
Mouse monoclonal Kv1.3 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-KCNN3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rhesus macaque |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNN3 antibody: synthetic peptide directed towards the C terminal of human KCNN3. Synthetic peptide located within the following region: ITELNDRSEDLEKQIGSLESKLEHLTASFNSLPLLIADTLRQQQQQLLSA |
Rabbit Polyclonal Anti-KCNC4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNC4 antibody: synthetic peptide directed towards the middle region of human KCNC4. Synthetic peptide located within the following region: NIDRNVTEILRVGNITSVHFRREVETEPILTYIEGVCVLWFTLEFLVRIV |
Rabbit Polyclonal Anti-KCNA10 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNA10 antibody: synthetic peptide directed towards the N terminal of human KCNA10. Synthetic peptide located within the following region: DVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRPGGSSFSNGKI |
Rabbit Polyclonal Anti-KCNQ2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ2 antibody: synthetic peptide directed towards the middle region of human KCNQ2. Synthetic peptide located within the following region: SIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAH |
Rabbit Polyclonal Anti-KCNQ2 Antibody
| Applications | IHC, WB |
| Reactivities | Hamster, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ2 antibody: synthetic peptide directed towards the N terminal of human KCNQ2. Synthetic peptide located within the following region: IDIMVLIASIAVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKL |
Rabbit Polyclonal Anti-KCNQ2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ2 antibody: synthetic peptide directed towards the middle region of human KCNQ2. Synthetic peptide located within the following region: GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI |
Rabbit polyclonal Kv7.3/KCNQ3 (Thr246) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human: Thr246, Mouse: Thr247, Rat: Thr247 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Kv7.3/KCNQ3 around the phosphorylation site of threonine 246 (G-G-TP-W-K). |
| Modifications | Phospho-specific |
KCNMA1 / BK Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Pig, Horse |
| Conjugation | Unconjugated |
| Immunogen | KCNMA1 / BK antibody was raised against synthetic 15 amino acid peptide from internal region of human KCNMA1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Hamster, Bovine, Horse, Rabbit, Pig, Turkey, Chicken, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%). |
KCNJ6 / GIRK2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Guinea pig, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Orang-Utan, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | KCNJ6 / GIRK2 antibody was raised against synthetic 18 amino acid peptide from N-terminus of human KCNJ6 / GIRK2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (100%); Panda, Bat (94%); Opossum (89%). |
KCNJ6 / GIRK2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Orang-Utan, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | KCNJ6 / GIRK2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human KCNJ6 / GIRK2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Pig (100%); Opossum (93%); Turkey, Platypus, Lizard (87%). |
Mouse Monoclonal Anti-Kv1.2 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-Kv1.6 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-KCNN4 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KCNN4 / KCa3.1 antibody was raised against synthetic 14 amino acid peptide from N-Terminus of human KCNN4. Percent identity with other species by BLAST analysis: Human, Gorilla, Bovine (100%); Marmoset, Panda, Dog, Rabbit, Pig (93%); Mouse, Rat, Guinea pig (86%). |
Anti-KCNA1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 460-472 amino acids of Human potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia) |
Anti-KCNH8 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1095-1107 amino acids of Human potassium voltage-gated channel, subfamily H (eag-related), member 8 |
Anti-KCNH8 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1095-1107 amino acids of Human potassium voltage-gated channel, subfamily H (eag-related), member 8 |
Anti-KCNC2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 16-30 amino acids of Human potassium voltage-gated channel, Shaw-related subfamily, member 2 |
Anti-KCNH3 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 95-144 amino acids of Human potassium voltage-gated channel, subfamily H (eag-related), member 3 |
Germany
Japan
United Kingdom
China
