Antibodies

View as table Download

Rabbit Polyclonal Anti-DTX4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen DTX4 antibody was raised against a 19 amino acid peptide near the center of human DTX4.

Rabbit Polyclonal Anti-ATG4B Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ATG4B antibody was raised against a 17 amino acid peptide near the carboxy terminus of human ATG4B.

Rabbit polyclonal anti-ATG4B antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ATG4B.

Rabbit Polyclonal Anti-ATG4B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-APG4B Antibody: synthetic peptide directed towards the C terminal of human APG4B. Synthetic peptide located within the following region: LGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEIL

Rabbit Polyclonal ATG4B Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A portion of amino acid 350-400 of human APG4B was used as the immunogen.

Carrier-free (BSA/glycerol-free) ATG4B mouse monoclonal antibody,clone OTI1A3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-ATG4B Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ATG4B

ATG4B mouse monoclonal antibody,clone OTI1A3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated