Germany
Japan
United Kingdom
China
USD 380.00
In Stock
Antibodies
View as table Download
Rabbit polyclonal IL8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8. |
SDF1 (CXCL12) (beta) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | E. Coli derived Recombinant recombinant Human SDF-1 beta |
SDF1 (CXCL12) (beta) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | E. Coli derived Recombinant recombinant Human SDF-1 beta |
Rabbit polyclonal CCL2 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CCL2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the C-terminal region of human CCL2. |
USD 285.00
5 Days
PF4 sheep polyclonal antibody, Purified
| Applications | ELISA, IHC |
| Reactivities | Human |
| Immunogen | PF4 antibody was raised against platelet Factor 4 (PF4) purified from human platelet releasate. |
Rabbit Polyclonal Anti-CCL18 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCL18 antibody: synthetic peptide directed towards the middle region of human CCL18. Synthetic peptide located within the following region: PQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA |
Anti-Human Eotaxin Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human Eotaxin (CCL11) |
Anti-Human Fractalkine Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human Fractalkine (CX3CL1) |
Anti-Human HCC-1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human HCC-1 (CCL14) (72 a.a.) |
Anti-Human I-309 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human I-309 (CCL1) |
Anti-Human SDF-1a Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human SDF-1α (CXCL12) |
Anti-Human TECK Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human TECK (CCL25) |
Anti-CCL2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 75-89 amino acids of Human C-C motif chemokine 2 |
Anti-CCL26 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 57-71 amino acids of Human chemokine (C-C motif) ligand 26 |
Anti-CCL15 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 94-103 amino acids of Human chemokine (C-C motif) ligand 15 |
Anti-CX3CL1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 368-381 amino acids of Human chemokine (C-X3-C motif) ligand 1 |
Anti-CCL17 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 73-86 amino acids of human chemokine (C-C motif) ligand 17 |
Anti-CXCL12 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 36-50 amino acids of human chemokine (C-X-C motif) ligand 12 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IHC
Isotypes
- IgG
Families
- Secreted Protein
Pathways
- Chemokine signaling pathway
Filter by
Target Symbol
- CXCL12 (6)
- CCL2 (5)
- CCL1 (3)
- CCL17 (3)
- CCL15 (2)
- CCL21 (2)
- CCL4 (2)
- CX3CL1 (2)
- CXCL14 (2)
- CXCL3 (2)
- CXCL8 (2)
- PF4 (2)
- CCL11 (1)
- CCL13 (1)
- CCL14 (1)
- CCL16 (1)
- CCL18 (1)
- CCL20 (1)
- CCL23 (1)
- CCL25 (1)
- CCL26 (1)
- CCL28 (1)
- CCL5 (1)
- CCL7 (1)
- CXCL1 (1)
- CXCL10 (1)
- CXCL11 (1)
- CXCL16 (1)
- CXCL2 (1)
- CXCL5 (1)
- CXCL9 (1)
- PF4V1 (1)
- XCL1 (1)