Antibodies

Jump to Filters
View as table Download
PAR6 (PARD6A) Rabbit Polyclonal Antibody
TA349428

USD 380.00

In Stock

Rabbit Polyclonal Anti-PARD6A Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PARD6A
SMURF 2 (SMURF2) Rabbit Polyclonal Antibody
TA349051

USD 484.00

5 Days

Rabbit Polyclonal Anti-DEPTOR Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DEPTOR antibody was raised against a 16 amino acid peptide near the center of human DEPTOR.
VPS25 Goat Polyclonal Antibody
TA303080

USD 375.00

In Stock

Goat Polyclonal Antibody against VPS25

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QPNVDTRQKQ, from the internal region of the protein sequence according to NP_115729.1.
MDM2 Rabbit Polyclonal Antibody
TA311995

USD 345.00

In Stock

Rabbit polyclonal anti-MDM2 antibody

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MDM2.
CBL Rabbit Polyclonal Antibody
TA321686

USD 345.00

4 Weeks

Anti-CBL (phospho-Tyr700) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of tyrosine 770 (T-E-Y(p)-M-T) derived from Human c-Cbl.
Modifications Phospho-specific
PAR6 (PARD6A) Rabbit Polyclonal Antibody
TA323360

USD 345.00

In Stock

Anti-PARD6A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 334-346 amino acids of human par-6 partitioning defective 6 homolog alpha (C. elegans)
ITCH Rabbit Polyclonal Antibody
TA312425

USD 345.00

In Stock

Rabbit polyclonal ITCH (Tyr420) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human ITCH around the phosphorylation site of tyrosine 420 (F-I-YP-G-N).
Modifications Phospho-specific
MDM2 Rabbit Polyclonal Antibody
TA325681

USD 345.00

4 Weeks

Rabbit Polyclonal MDM2 (Ser166) Antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human MDM2 around the phosphorylation site of Sersine 166.
Modifications Phospho-specific
EAP30 (SNF8) Rabbit Polyclonal Antibody
TA329321

USD 375.00

5 Days

Rabbit Polyclonal anti-EAP30 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EAP30 antibody: synthetic peptide directed towards the N terminal of human EAP30. Synthetic peptide located within the following region: MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEF
WWP1 Rabbit Polyclonal Antibody
TA329805

USD 375.00

5 Days

Rabbit Polyclonal Anti-WWP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WWP1 antibody: synthetic peptide directed towards the N terminal of human WWP1. Synthetic peptide located within the following region: ATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAIYTEVVVDGEIT
PAR6 (PARD6A) Goat Polyclonal Antibody
TA302913

USD 375.00

5 Days

Goat Polyclonal Antibody against PARD6A

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-GSRIRGDGSGFSL, from the C Terminus of the protein sequence according to NP_058644.
MDM2 Rabbit Polyclonal Antibody
TA350708

USD 345.00

In Stock

Rabbit Polyclonal Anti-MDM2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human MDM2
SMURF 2 (SMURF2) Rabbit Polyclonal Antibody
TA350762

USD 345.00

In Stock

Rabbit Polyclonal Anti-SMURF2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SMURF2
Dynamin 2 (DNM2) Rabbit Polyclonal Antibody
TA351149

USD 345.00

In Stock

Rabbit Polyclonal Anti-DNM2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human DNM2
VPS4B Rabbit Polyclonal Antibody
TA351918

USD 345.00

In Stock

Rabbit Polyclonal Anti-VPS4B Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human VPS4B
VPS36 Rabbit Polyclonal Antibody
TA351920

USD 345.00

In Stock

Rabbit Polyclonal Anti-VPS36 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human VPS36