Rabbit Polyclonal Anti-JUN Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human JUN |
Rabbit Polyclonal Anti-JUN Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human JUN |
Rabbit Polyclonal c-jun Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit anti-STAT5A (Phospho-Tyr694) polyclonal antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT5A around the phosphorylation site of tyrosine 694 (D-G-YP-V-K). |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ABL1 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ABL1 |
Rabbit polyclonal NRG1 isoform-10 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human NRG1 isoform-10. |
Rabbit polyclonal JUN Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This JUN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 222-251 amino acids from the C-terminal region of human JUN. |
Rabbit polyclonal c-Jun (Phospho-Ser63) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human c-Jun around the phosphorylation site of Serine 63. |
Modifications | Phospho-specific |
Rabbit Polyclonal ELK1 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit polyclonal STAT5B (Ser731) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human STAT5B around the phosphorylation site of serine 731 (A-P-SP-P-A). |
Modifications | Phospho-specific |
Rabbit polyclonal Elk-1(Ab-383) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This antiserum was produced against synthesized non-phosphopeptide derived from human Elk-1 around the phosphorylation site of Serine 383. |
Rabbit polyclonal STAT5B (Ab-731) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human STAT5B around the phosphorylation site of serine 731(A-P-S-P-A). |
Anti-CBL (phospho-Tyr700) Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of tyrosine 770 (T-E-Y(p)-M-T) derived from Human c-Cbl. |
Modifications | Phospho-specific |
Rabbit polyclonal Phospho-cJun(S63) Antibody
Applications | Dot, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This cJun Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S63 of human cJun. |
Modifications | Phospho-specific |
Rabbit polyclonal c-Jun (Phospho-Ser243) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human c-Jun around the phosphorylation site of serine 243 (P-L-SP-P-I). |
Modifications | Phospho-specific |
Rabbit polyclonal c-Jun (Ab-170) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human c-Jun around the phosphorylation site of Tyrosine 170. |
Rabbit polyclonal MYC antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human Myc. |
NRG1 (Isoform 10) (N-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide - KLH conjugated |
Rabbit polyclonal anti-ABL1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABL1. |
Anti-ABL1/ABL2 (phospho-Tyr393/429) Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of tyrosine 393/429 (D-T-Y(p)-T-A) derived from Human ABL1/2. |
Modifications | Phospho-specific |
Anti-ELK1 Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.387~391 (P-R-S-P-A) derived from Human Elk1. |
Rabbit polyclonal Phospho-cJun(S63) Antibody
Applications | Dot, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This cJun Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S63 of human cJun. |
Modifications | Phospho-specific |
Rabbit polyclonal Phospho-STAT5a(Y694) Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This STAT5a Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding Y694 of human STAT5a. |
Modifications | Phospho-specific |
Rabbit Polyclonal C-myc antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human C-myc |
Rabbit polyclonal c-Jun (Ab-243) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human c-Jun around the phosphorylation site of serine 243. |
Anti-Human Heregulinβ-1 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human Heregulinβ-1 |
Rabbit Polyclonal Anti-JUN Antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-JUN antibody: synthetic peptide directed towards the N terminal of human JUN. Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP |
Rabbit anti-STAT5A (Phospho-Ser780) polyclonal antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT5A around the phosphorylation site of serine 780 (R-L-SP-P-P). |
Modifications | Phospho-specific |
Anti-ELK1 (Phospho-Ser389) Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of serine 389 (P-R-S(p)-P-A) derived from Human Elk-1. |
Modifications | Phospho-specific |
Rabbit polyclonal STAT5b Antibody (C-term)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This STAT5b antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 760-787 amino acids from the C-terminal region of human STAT5b. |
Rabbit anti STAT5 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide surrounding to the C-terminus of STAT5 protein from human, mouse and rat origins. |
Rabbit anti STAT5 (pY694) Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide surrounding to the epitope -DGYVK-- with phosphorylation sites at Tyr694 of STAT5 protein from human, mouse and rat origins. |
Rabbit anti STAT5 (Paired Y694) Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide surrounding to the epitope -DGYVK-- without phosphorylation sites at Tyr694 of STAT5 protein from human, mouse and rat origins. |
Rabbit anti-ELK1 (Phospho-Thr417) polyclonal antibody (Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanElk-1 around the phosphorylation site of threonine 417 (L-S-TP-P-V). |
Modifications | Phospho-specific |
Anti-STAT5B Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 46-351 amino acids of Human Signal transducer and activator of transcription 5B |
Anti-STAT5B rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 46-351 amino acids of Human Signal transducer and activator of transcription 5B |
Rabbit Polyclonal Anti-CRK Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CRK |
Rabbit Polyclonal Anti-NRG1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NRG1 |